콘텐츠로 건너뛰기
Merck
모든 사진(6)

주요 문서

HPA001200

Sigma-Aldrich

Anti-EGFR antibody produced in rabbit

enhanced validation

Ab1, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-Epidermal growth factor receptor precursor antibody produced in rabbit, Anti-Receptor tyrosine-protein kinase ErbB-1 antibody produced in rabbit

로그인조직 및 계약 가격 보기


About This Item

MDL number:
UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.43

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

기술

immunohistochemistry: 1:50-1:200

면역원 서열

EFKDSLSINATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKIIS

UniProt 수납 번호

응용 분야

research pathology

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... EGFR(1956)

유사한 제품을 찾으십니까? 방문 제품 비교 안내

일반 설명

The gene epidermal growth factor receptor (EGFR) is mapped to human chromosome 7p12. It belongs to receptor tyrosine kinase family. The protein is mainly localized in the plasma membrane.

면역원

Epidermal growth factor receptor precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-EGFR antibody produced in rabbit is suitable for use in epitope mapping to study the antibody cross-reactivity with a multi-target fragment library.
Anti-EGFR antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

Epidermal growth factor receptor (EGFR) plays an important role in cell proliferation, survival, and differentiation. Interaction between EGFR and its ligands results in stimulation of several transduction pathways including the RAS/RAF/MEK/MAPK, PLC-γ/PKC, PI3K/AKT, JAK/STAT, and NF-κB cascades. Presence of ligand stimulates EGFR phosphorylation. This event subsequently recruits ubiquitin ligase, CBL, to EGFR. Activated EGFR-ligand complex is removed from the cell surface via endocytosis and is degraded in the lysosomes to attenuate the signaling. EGFR hyper-phosphorylation is linked to cell proliferation and thereby tumor development. EGFR is associated with a number of human solid tumors, including lung, breast, prostate, bladder, colon, head and neck, ovarian and salivary duct carcinomas.
Density-enhanced phosphatase-1 (DEP1) dephosphorylates and thereby stabilizes EGFR. The transmembrane protein LRIG1 and suppressors of cytokine signaling-5 (SOCS5) binds and destabilizes EGFR. Protein tyrosine phosphatase PTPN3 and PHD3 promotes EGFR endocytic degradation.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST78874

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Y Yarden
European journal of cancer (Oxford, England : 1990), 37 Suppl 4, S3-S8 (2001-10-13)
Growth factors and their transmembrane receptor tyrosine kinases play important roles in cell proliferation, survival, migration and differentiation. One group of growth factors, comprising epidermal growth factor (EGF)-like proteins and neuregulins, stimulates cells to divide by activating members of the
J Guillermo Paez et al.
Science (New York, N.Y.), 304(5676), 1497-1500 (2004-05-01)
Receptor tyrosine kinase genes were sequenced in non-small cell lung cancer (NSCLC) and matched normal tissue. Somatic mutations of the epidermal growth factor receptor gene EGFR were found in 15of 58 unselected tumors from Japan and 1 of 61 from
Gal Gur et al.
The EMBO journal, 23(16), 3270-3281 (2004-07-30)
Kekkon proteins negatively regulate the epidermal growth factor receptor (EGFR) during oogenesis in Drosophila. Their structural relative in mammals, LRIG1, is a transmembrane protein whose inactivation in rodents promotes skin hyperplasia, suggesting involvement in EGFR regulation. We report upregulation of
Elton P Hudson et al.
Scientific reports, 2, 706-706 (2012-10-11)
As antibody-based diagnosis and therapy grow at an increased pace, there is a need for methods which rapidly and accurately determine antibody-antigen interactions. Here, we report a method for the multiplex determination of antibody epitopes using bacterial cell-surface display. A
Cheng-Yao Chiang et al.
Clinical cancer research : an official journal of the American Association for Cancer Research, 21(24), 5601-5611 (2015-08-20)
Mass spectrometry-based biomarker discovery has clinical benefit. To identify novel biomarkers for urothelial carcinoma, we performed quantitative proteomics on pooled urine pairs from patients with and without urothelial carcinoma. Shot-gun proteomics using liquid chromatography-tandem mass spectrometry and stable isotope dimethyl

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.