Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

SAB2102971

Sigma-Aldrich

Anti-ZRANB2 (ab1) antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-DKFZp686J1831, Anti-DKFZp686N09117, Anti-FLJ41119, Anti-ZIS, Anti-Zinc finger, RAN-binding domain containing 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

37 kDa

Espèces réactives

human, horse, rat, bovine, mouse, guinea pig, rabbit, dog

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès UniProt

O95218

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ZRANB2(9406)

Description générale

Zinc finger ran-binding domain containing protein 2 (ZRANB2) is a part of supraspliceosome. It is present in the nucleus of human cells. This protein contains a C-terminal arginine/serine rich domain and two N-terminal RanBP2-type zinc fingers. ZRANB2 gene is located on human chromosome 1p31.1.

Immunogène

Synthetic peptide directed towards the N terminal region of human ZRANB2

Actions biochimiques/physiologiques

ZRANB2 is a splice factor required for alternative splicing of SFRS10/TRA2B transcripts. It may interfere with constitutive 5′-splice site selection. Zinc finger Ran-binding domain containing protein 2 (ZRANB2) promotes differential splicing of numerous primary transcripts. Alternative splicing of transcripts might be associated with cancer. ZRANB2 is upregulated in grade III ovarian serous papillary carcinoma. The C-terminal interacts with spliceosomal proteins and the N- terminal helps in RNA recognition.

Séquence

Synthetic peptide located within the following region: KTCSNVNWARRSECNMCNTPKYAKLEERTGYGGGFNERENVEYIEREESD

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
QC11328

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Crystallization of a ZRANB2--RNA complex
Loughlin F, et al.
Acta Crystallographica Section F, Structural Biology and Crystallization Communications, 64(12) (2008)
Altered microRNA expression profiles in postmortem brain samples from individuals with schizophrenia and bipolar disorder
Moreau M, et al.
Biological Psychiatry, 69(2) (2011)
ZRANB2: Structural and functional insights into a novel splicing protein
Mangs A, et al.
The International Journal of Biochemistry & Cell Biology, 40(11) (2008)
Yee Hwa J Yang et al.
Molecular biology reports, 40(9), 5381-5395 (2013-05-15)
Alternative splicing is a major source of protein diversity in humans. The human splicing factor zinc finger, Ran-binding domain containing protein 2 (ZRANB2) is a splicing protein whose specific endogenous targets are unknown. Its upregulation in grade III ovarian serous

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique