추천 제품
생물학적 소스
mouse
Quality Level
결합
unconjugated
항체 형태
purified immunoglobulin
항체 생산 유형
primary antibodies
클론
3D7, monoclonal
양식
buffered aqueous solution
종 반응성
human
기술
indirect ELISA: suitable
western blot: 1-5 μg/mL
동형
IgG2aκ
GenBank 수납 번호
UniProt 수납 번호
배송 상태
dry ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... IL23R(149233)
관련 카테고리
일반 설명
Interleukin 23 receptor (IL23R) gene codes for a subunit of the IL-23 receptor. The gene is mapped to human chromosome 1p31.3.
면역원
IL23R (NP_653302, 553 a.a. ~ 628 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
LNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGIVNEELPSINTYFPQNILESHFNRISLLE
Sequence
LNQGECSSPDIQNSVEEETTMLLENDSPSETIPEQTLLPDEFVSCLGIVNEELPSINTYFPQNILESHFNRISLLE
생화학적/생리학적 작용
Interleukin 23 receptor (IL23R) IL-12Rβ1 and forms IL-23 complex, which is essential for IL-23 signaling. It constitutively combines with Janus kinase 2 (JAK2). IL23R attaches to transcription activator signal transducer and activator of transcription 3 (STAT3) in a ligand-dependent manner and has a proinflammatory function. IL23R gene defends against Crohn′s disease.
물리적 형태
Solution in phosphate buffered saline, pH 7.4
법적 정보
GenBank is a registered trademark of United States Department of Health and Human Services
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
nwg
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
가장 최신 버전 중 하나를 선택하세요:
Anthony W Segal
European journal of clinical investigation, 48 Suppl 2, e12983-e12983 (2018-06-23)
Crohn's disease (CD) is caused by a trigger, almost certainly enteric infection by one of a multitude of organisms that allows faeces access to the tissues, at which stage the response of individuals predisposed to CD is abnormal. In CD
Joerg Ermann et al.
Proceedings of the National Academy of Sciences of the United States of America, 111(25), E2559-E2566 (2014-06-14)
T-bet(-/-).Rag2(-/-) (TRUC) mice spontaneously develop microbiota-driven, TNF-mediated large bowel inflammation that resembles human ulcerative colitis. We show here that IL-23 and IL-1-dependent secretion of IL-17A by innate lymphoid cells (ILCs; defined as CD45(+)lin(-)Thy1(hi)NKp46(-)) is a second critical pathway in this
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.