SAB2105544

Anti-SLC2A8 antibody produced in rabbit

affinity isolated antibody

• 동의어(들): Anti-GLUT8, Anti-GLUTX1
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 51 kDa
• 종 반응성: rabbit, human
• 농도: 0.5 mg - 1 mg/mL
• 기술: western blot: suitable
• NCBI 수납 번호: NM_014580
• UniProt 수납 번호: Q9NY64
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SLC2A8(29988)

설명

일반 설명

Solute carrier family 2 member 8 (SLC2A8)/Glucose transporter 8 (GLUT8), a class III sugar transporter, is expressed in the testis and brain. In the brain, GLUT8 is expressed mainly in the cerebral cortex, hippocampus, amygdala, and hypothalamus.

면역원

Synthetic peptide directed towards the middle region of human SLC2A8

생화학적/생리학적 작용

Solute carrier family 2 member 8 (SLC2A8)/glucose transporter 8 (GLUT8) plays a key role in modulating the transport of fructose and the utilization of mammalian fructose. It is a trehalose transporter found in mammals that is necessary for trehalose-induced autophagy. SLC2A8 can also transport intracellular hexose. Hence, it might serve as a multifunctional sugar transporter.

서열

Synthetic peptide located within the following region: VLSGVVMVFSTSAFGAYFKLTQGGPGNSSHVAISAPVSAQPVDASVGLAW

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable