콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

SAB2102766

Sigma-Aldrich

Anti-ZFP36 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-G0S24, Anti-GOS24, Anti-NUP475, Anti-RNF162A, Anti-Zinc finger protein 36, C3H type, homolog (mouse)

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

34 kDa

종 반응성

bovine, human, guinea pig, rabbit, dog, sheep

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... ZFP36(7538)

면역원

Synthetic peptide directed towards the middle region of human ZFP36

생화학적/생리학적 작용

ZFP36 is a probable regulatory protein with a novel zinc finger structure involved in regulating the response to growth factors. Knockdown of ZFP36 increased both cognate macrophage gene mRNAs and inflammatory tumor necrosis factor protein release. Overexpression of ZFP36 resulted in decreased levels of the same genes supporting its role in regulating macrophage gene expression. Multiple phosphorylation sites in ZFP36 in mammalian cells were reported. ZFP36 can be phosphorylated by JNK as well as by the other members of the greater MAP kinase family. Gene expression profiling predicts clinical outcome of prostate cancer. Inappropriate ZFP36 production may be one factor that contributes to higher rheumatoid arthritis disease activity.

서열

Synthetic peptide located within the following region: PSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFE

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Lynnae D Hyatt et al.
PloS one, 9(10), e109072-e109072 (2014-10-10)
Zinc finger protein 36, C3H type-like 1 (ZFP36L1) is one of several Zinc Finger Protein 36 (Zfp36) family members, which bind AU rich elements within 3' untranslated regions (UTRs) to negatively regulate the post-transcriptional expression of targeted mRNAs. The prototypical
Rebecca T Hahn et al.
Atherosclerosis, 234(2), 391-400 (2014-04-22)
Glucocorticoid-induced leucine zipper (GILZ) represents an anti-inflammatory mediator, whose downregulation has been described in various inflammatory processes. Aim of our study was to decipher the regulation of GILZ in vascular inflammation. Degenerated aortocoronary saphenous vein bypass grafts (n = 15)

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.