SAB1404658

Monoclonal Anti-SOCS3 antibody produced in mouse

clone 2E5, purified immunoglobulin, buffered aqueous solution

• 동의어(들): ATOD4, CIS3, Cish3, MGC71791, SOCS-3, SSI-3, SSI3
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 2E5, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~50.86 kDa
• 종 반응성: human
• 기술: capture ELISA: suitable; indirect ELISA: suitable
• 동형: IgG2aκ
• NCBI 수납 번호: BC060858
• UniProt 수납 번호: O14543
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... SOCS3(9021)

설명

일반 설명

Suppressor of cytokine signaling 3 (SOCS3) is encoded by the gene mapped to human chromosome 17q25.3.The encoded protein belongs to the SOCS protein family.

면역원

SOCS3 (AAH60858, 1 a.a. ~ 225 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MVTHSKFPAAGMSRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLLSAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCVLKLVHHYMPPPGAPSFPSPPTEPSSEVPEQPSAQPLPGSPPRRAYYIYSGGEKIPLVLSRPLSSNVATLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL

생화학적/생리학적 작용

Suppressor of cytokine signaling 3 (SOCS3) plays a vital role in cytokine signaling. The encoded protein has an ability to bind and inhibit janus kinases (JAKs), turning off signal transducers and activators of transcription 3 (STAT3) signaling in response to interferon (IFN)-6 stimulation. Downregulated expression of the gene enhance the growth and metastasis of colorectal cancer (CRC). Thus, targeting IL-6/STAT3/SOCS3 signaling pathway can be considered as a potent therapeutic strategy for CRC.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable