SAB1404011

Anti-KRAS Antibody

mouse monoclonal, 4F3

• 동의어(들): C-K-RAS, K-RAS2A, K-RAS2B, K-RAS4A, K-RAS4B, KI-RAS, KRAS1, KRAS2, NS3
• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 제품명: Monoclonal Anti-KRAS antibody produced in mouse, clone 4F3, purified immunoglobulin, buffered aqueous solution
• 생물학적 소스: mouse
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: purified immunoglobulin
• 항체 생산 유형: primary antibodies
• 클론: 4F3, monoclonal
• 양식: buffered aqueous solution
• 분자량: antigen ~38.21 kDa
• 종 반응성: human
• 기술: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• 동형: IgG2aκ
• NCBI 수납 번호: NM_004985
• UniProt 수납 번호: P01116
• 배송 상태: dry ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... KRAS(3845)

설명

일반 설명

This gene, a Kirsten ras oncogene homolog from the mammalian ras gene family, encodes a protein that is a member of the small GTPase superfamily. A single amino acid substitution is responsible for an activating mutation. The transforming protein that results is implicated in various malignancies, including lung adenocarcinoma, mucinous adenoma, ductal carcinoma of the pancreas and colorectal carcinoma. Alternative splicing leads to variants encoding two isoforms that differ in the C-terminal region. (provided by RefSeq)

c-K-Ras or KRAS (Kirsten rat sarcoma-2 virus oncogene) is a small GTP-binding protein. The gene encoding it is localized on human chromosome 12p12.1. KRAS has two splice variants, that is, KRASA and KRASB (KRAS proto-oncogenes). Expression of KRASA is restricted to specific tissues whereas KRASB is ubiquitously expressed.

면역원

KRAS (NP_004976, 16 a.a. ~ 125 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTV

애플리케이션

Monoclonal Anti-KRAS antibody produced in mouse has been used in Western Blotting.

생화학적/생리학적 작용

KRAS (Kirsten rat sarcoma-2 virus oncogene) mutation has been associated with early rectal cancer and colorectal cancer. The protein has a role in signaling pathways.

KRAS (kirsten rat sarcoma-2 virus oncogene) upon binding to a cell surface receptor, including EGFR functions as a self-inactivating signal transducer by cycling from GDP- to GTP-bound states. Mutation in the gene leads to poor prognosis of early rectal cancer.

물리적 형태

Solution in phosphate buffered saline, pH 7.4

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 1
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable