추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous glycerol solution
종 반응성
human
기술
immunohistochemistry: 1:200-1:500
면역원 서열
CTAQNLLGSISTIGRLQVEGARVVAEPGLDVPEGAALNLSCRLLGGPGPVGNSTFAWFWNDRRLHAEPVPTLAFTHVARAQAGMYH
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SIGLEC1(6614)
일반 설명
Sialic acid-binding Ig-like lectin 1 (SIGLEC1), also known as CD169, is a myeloid-cell surface receptor that belongs to the Siglec family. It is expressed on the surface of specific macrophage subsets and its precursor monocytes. In addition, it also shows its expression on some dendritic cells or T lymphocytes. SIGLEC1 is encoded by the gene mapped to human chromosome 20p. The protein structure is characterized with 17 Ig-like domains, including an N-terminal V-set domain and 16 C2-set domains.
면역원
sialic acid binding Ig-like lectin 1, sialoadhesin recombinant protein epitope signature tag (PrEST)
애플리케이션
Anti-SIGLEC1 antibody produced in rabbit has been used in immunohistochemistry.
생화학적/생리학적 작용
Sialic acid-binding Ig like lectin 1 (SIGLEC1) aids in cell-to-cell adhesion and cell-pathogen interactions. It also enables antigen presentation and induces adaptive immune responses. SIGLEC1 facilitates attenuation and induces anti-tumor immunity. It suppresses anti-viral innate immune response by inducing ubiquitin ligase tripartite motif-containing 27 (TRIM27) mediated TANK binding kinase 1 (TBK1) degradation. SIGLEC1 is used as a predictive molecular marker in several autoimmune diseases, such as Grave′s diseases. Upregulationof the SIGLEC1 has been observed in patients with systemic sclerosis (SSc).
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST85314
물리적 형태
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Michael R York et al.
Arthritis and rheumatism, 56(3), 1010-1020 (2007-03-01)
Microarray analyses of peripheral blood leukocytes have shown that patients with systemic lupus erythematosus express increased levels of type I interferon (IFN)-regulated genes. In this study we examined gene expression by peripheral blood mononuclear cells (PBMCs) from patients with systemic
Robert M Clancy et al.
Journal of immunology (Baltimore, Md. : 1950), 202(1), 48-55 (2018-12-07)
Given that diseases associated with anti-SSA/Ro autoantibodies, such as systemic lupus erythematosus and Sjögren syndrome, are linked with an upregulation of IFN and type I IFN-stimulated genes, including sialic acid-binding Ig-like lectin 1 (Siglec-1), a receptor on monocytes/macrophages, recent attention
Dana Kidder et al.
Journal of nephropathology, 6(2), 97-102 (2017-05-12)
Anti-neutrophil cytoplasmic antibody (ANCA)-associated glomerulonephritis (AAGN) can be classified into; focal, crescentic, mixed and sclerotic classes. Macrophages and T lymphocytes are key players in mediating renal injury. The frequency of macrophage and T lymphocytes in different histological classes is unclear.
Javier Martinez-Picado et al.
Nature communications, 7, 12412-12412 (2016-08-12)
Siglec-1/CD169 is a myeloid-cell surface receptor critical for HIV-1 capture and infection of bystander target cells. To dissect the role of SIGLEC1 in natura, we scan a large population genetic database and identify a loss-of-function variant (Glu88Ter) that is found
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.