추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
mouse, human, rat
향상된 검증
RNAi knockdown
Learn more about Antibody Enhanced Validation
기술
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:200-1:500
면역원 서열
EVEDQDSKEAKKPNIINFDTSLPTSHTYLGADMEEFHGRTLHDDDSCQVIPVLPQVMMILIPGQTLPLQLFHPQEVSMVRNLIQKDRTFAVLAYSNVQERE
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... CRBN(51185)
일반 설명
The gene CRBN (cereblon) is mapped to human chromosome 3p26.2. It is strongly expressed in the brain. The encoded protein has a conserved Lon (ATP-dependent protease La) domain. The CRBN protein is present in the cytoplasm and nucleus.
CRBN protein interacts with:
CRBN protein interacts with:
면역원
cereblon recombinant protein epitope signature tag (PrEST)
애플리케이션
All Prestige Antibodies®Powered by Atlas Antibodies is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.
Anti-CRBN antibody produced in rabbit has been used in western blotting.
Anti-CRBN antibody produced in rabbit has been used in western blotting.
Anti-CRBN antibody produced in rabbit has been used in immunohistochemistry
생화학적/생리학적 작용
CRBN (cereblon) mainly recruits substrates for E3 ubiquitin ligase. It interacts with BKCa (calcium-activated potassium channel subunit α-1), ClC-2 (chloride channel protein 2), AMPK (5′-AMP-activated protein kinase), PSMB4 (proteasome subunit β 4), ikaros (IKZF1), aiolos (IKZF3) and MEIS2 (Meis1-related protein). These interactions might be required for sending the proteins for ubiquitination by the E3 ubiquitin ligase. Degradation of IKZF1 (ikaros family zinc finger protein 1) and IKZF3 by lenalidomide (immunomodulatory drug)-bound CRBN helps in anti-myeloma effect of lenalidomide. Similarly, treatment with thalidomide in CRBN positive cells is effective in elderly patients with multiple myeloma. CRBN might also be associated with autosomal recessive nonsyndromic intellectual disability.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST79292
물리적 형태
Solution in phosphate buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Immunomodulatory drugs disrupt the cereblon-CD147-MCT1 axis to exert antitumor activity and teratogenicity.
Eichner R, et al.
Nature Medicine, 22, 735-735 (2016)
Dolores Del Prete et al.
The Journal of biological chemistry, 291(33), 17209-17227 (2016-06-22)
The amyloid precursor protein (APP), whose mutations cause Alzheimer disease, plays an important in vivo role and facilitates transmitter release. Because the APP cytosolic region (ACR) is essential for these functions, we have characterized its brain interactome. We found that
Thalidomide-based induction regimens are as effective as bortezomib-based regimens in elderly patients with multiple myeloma with cereblon expression.
Jung SH, et al.
Annals of Hematology, 95, 1645-1651 (2016)
Microduplications of 3p26.3p26.2 containing CRBN gene in patients with intellectual disability and behavior abnormalities.
Papuc SM, et al.
European Journal of Medical Genetics, 58, 319-323 (2015)
Cereblon inhibits proteasome activity by binding to the 20S core proteasome subunit beta type 4.
Lee KM, et al.
Biochemical and Biophysical Research Communications, 427, 618-618 (2012)
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.