SAB2108266

Anti-GAPDH Antibody

rabbit polyclonal

• UNSPSC 코드: 12352203
• NACRES: NA.41

속성

• 제품명: Anti-GAPDH antibody produced in rabbit, affinity isolated antibody
• 생물학적 소스: rabbit
• Quality Level: 100
• 결합: unconjugated
• 항체 형태: affinity isolated antibody
• 항체 생산 유형: primary antibodies
• 클론: polyclonal
• 양식: buffered aqueous solution
• 분자량: 36kDa
• 종 반응성: guinea pig, rat, horse, human, mouse
• 농도: 0.5 mg - 1 mg/mL
• 기술: immunoblotting: suitable
• NCBI 수납 번호: NM_002046
• UniProt 수납 번호: P04406
• 배송 상태: wet ice
• 저장 온도: −20°C
• 타겟 번역 후 변형: unmodified
• 유전자 정보: human ... GAPDH(2597)

설명

일반 설명

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) localizes in the cytoplasm but can be translocated to the nucleus depending on cellular conditions. It is a tetramer containing identical chains. The gene encoding this protein is localized on human chromosome 12p13.

면역원

Synthetic peptide directed towards the middle region of human GAPDH

애플리케이션

Anti-GAPDH antibody produced in rabbit has been used in western blotting.

생화학적/생리학적 작용

Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) catalyzes the reversible oxidative phosphorylation of glyceraldehyde-phosphate, which is a critical energy-yielding step in carbohydrate metabolism. It binds to several proteins including actin, tubulin, amyloid precursor, polyglutamine peptides, DRPLA (dentatorubral-pallidoluysian atrophy) and huntingtin. Phosphorylated GAPDH associates with cytoskeletal elements and controls microtubule dynamics in the early secretory pathway. GAPDH is also a component of the functional GAIT (interferon-γ-activated inhibitor of translation) mRNP (messenger ribonucleoprotein). GAPDH expression is dysregulated during melanoma progression.

서열

Synthetic peptide located within the following region: KAGAHLQGGAKRVIISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNC

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

안전성 정보

• Storage Class Code: 10 - Combustible liquids
• WGK: WGK 3
• Flash Point (°F): Not applicable
• Flash Point (°C): Not applicable