추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
제품 라인
Prestige Antibodies® Powered by Atlas Antibodies
양식
buffered aqueous glycerol solution
종 반응성
human
기술
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
면역원 서열
APLDTPTPMVPTSRVPGTLAPVATSLSPASNLPRSSASAAPSQAEPACPPRQACGGGGAHGPGWQA
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... ORAI3(93129)
일반 설명
ORAI3 (ORAI calcium release-activated calcium modulator 3) is one of the three isoforms of the highly selective Ca2+ channel called ORAI. This isoform is exclusive to mammals. It contains an ORAI domain in its N-terminal, which is completely conserved. This protein, along with ORAI1, makes the arachidonate-regulated Ca2+ (ARC) channel, which is store-independent.
면역원
Protein orai-3 recombinant protein epitope signature tag (PrEST)
애플리케이션
Anti-ORAI3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
생화학적/생리학적 작용
ORAI3 (ORAI calcium release-activated calcium modulator 3) is a key member of the Ca2+ release-activated Ca2+ (CRAC) pathway, which is the predominant pathway to allow the entry of Ca2+ into the cell. This channel is activated when it either interacts with STIM1, or in the presence of 2-aminoethoxydiphenyl borate (2-APB). It is up-regulated in breast cancer cells, and in MCF-7 BC cell line it promotes cell cycle, cell growth and survival. It also regulates c-myc proto-oncogene, though the MAP kinase pathway. This channel is also controlled by estrogen receptor (ER)α, and in ERα+ breast cancer, it activates store-operated Ca2+ entry (SOCE), and facilitates tumorigenesis. In non-small cell lung adenocarcinoma, it might activate Akt pathway, which is responsible for cell proliferation and cell cycle progression.
특징 및 장점
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
결합
Corresponding Antigen APREST73073
물리적 형태
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
법적 정보
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 1
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
개인 보호 장비
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
가장 최신 버전 중 하나를 선택하세요:
Estella Zuccolo et al.
Oncotarget, 9(57), 31098-31119 (2018-08-21)
Store-operated Ca2+ entry (SOCE) provides a major Ca2+ entry route in cancer cells. SOCE is mediated by the assembly of Stim and Orai proteins at endoplasmic reticulum (ER)-plasma membrane junctions upon depletion of the ER Ca2+ store. Additionally, Stim and
Malika Faouzi et al.
Biochimica et biophysica acta, 1833(3), 752-760 (2012-12-26)
Members of the Orai family are highly selective calcium ion channels that play an important role in store-operated calcium entry. Among the three known Orai isoforms, Orai3 has gained increased attention, notably for its emerging role in cancer. We recently
Rajender K Motiani et al.
FASEB journal : official publication of the Federation of American Societies for Experimental Biology, 27(1), 63-75 (2012-09-21)
Store-operated Ca(2+) entry (SOCE) encoded by Orai1 proteins is a ubiquitous Ca(2+)-selective conductance involved in cellular proliferation and migration. We recently described up-regulation of Orai3 channels that selectively mediate SOCE in estrogen receptor α-expressing (ERα(+)) breast cancer cells. However, the
Francesco Lodola et al.
Oncotarget, 8(56), 95223-95246 (2017-12-10)
Endothelial colony forming cells (ECFCs) represent a population of truly endothelial precursors that promote the angiogenic switch in solid tumors, such as breast cancer (BC). The intracellular Ca2+ toolkit, which drives the pro-angiogenic response to VEGF, is remodelled in tumor-associated
Judith Bergsmann et al.
The Journal of biological chemistry, 286(36), 31565-31575 (2011-07-05)
STIM1 and Orai represent the key components of Ca(2+) release-activated Ca(2+) channels. Activation of Orai channels requires coupling of the C terminus of STIM1 to the N and C termini of Orai. Although the latter appears to be central in
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.