콘텐츠로 건너뛰기
Merck
모든 사진(6)

주요 문서

HPA012657

Sigma-Aldrich

Anti-PLA2R1 Antibody

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, rabbit polyclonal

동의어(들):

CLEC13C, PLA2-R, PLA2G1R, PLA2IR

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

제품명

Anti-PLA2R1 antibody produced in rabbit, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
Learn more about Antibody Enhanced Validation

기술

immunohistochemistry: 1:500-1:1000
western blot: 0.04-0.4 μg/mL

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... PLA2R1(22925)

일반 설명

Phospholipase A2 receptor 1 (PLA2R1) is a type I transmembrane glycoprotein, which is a member of mannose receptor family. It consists of NH2-terminal cysteine-rich domain, a fibronectin-like type II (FNII) domain, a tandem repeat of 8 C-type lectin-like domains (CTLD) and a short intracellular COOH-terminal region. PLA2R1 is localized in the podocytes of kidney. The gene is located on human chromosome 2q24.

면역원

Phospholipase a2 receptor 1, 180kda recombinant protein epitope signature tag (PrEST)

Sequence
EEKTWHEALRSCQADNSALIDITSLAEVEFLVTLLGDENASETWIGLSSNKIPVSFEWSNDSSVIFTNWHTLEPHIFPNRSQLCVSAEQSEGHWKVKNCEERLFYICKKAGHVLSDAESGCQEGWERHGGFCYKID

애플리케이션

Anti-PLA2R1 antibody produced in rabbit has been used in immunohistochemistry and indirect immunofluorescence.

생화학적/생리학적 작용

Phospholipase A2 receptor 1 (PLA2R1) is implicated in primary membranous nephropathy (PMN).

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST72110

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Multifunctional activity of the extracellular domain of the M-type (180 kDa) membrane receptor for secretory phospholipases A2.
Ancian P, et al.
The Biochemical Journal, 34(40), 13146-13151 (1995)
Response to immunosuppressive therapy in PLA 2 R-associated and non-PLA 2 R-associated idiopathic membranous nephropathy: a retrospective, multicenter cohort study
Wang J, et al.
BMC Nephrology, 18(1), 227-227 (2017)
PLA 2 R binds to the annexin A2-S100A10 complex in human podocytes
Fresquet M, et al.
Scientific Reports, 7(1), 6876-6876 (2017)
David Vindrieux et al.
Cancer research, 73(20), 6334-6345 (2013-09-07)
Little is known about the physiological role of the phospholipase A2 receptor (PLA2R1). PLA2R1 has been described as regulating the replicative senescence, a telomerase-dependent proliferation arrest. The downstream PLA2R1 signaling and its role in cancer are currently unknown. Senescence induction
Maxime Dauvergne et al.
Medicine, 94(30), e1243-e1243 (2015-07-30)
The association between membranous nephropathy (MN) and immunological disorder-related liver disease has not been extensively investigated, and the specific features of this uncommon association, if any, remain to be determined.We retrospectively identified 10 patients with this association. We aimed to

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.