콘텐츠로 건너뛰기
Merck
모든 사진(8)

주요 문서

HPA005533

Sigma-Aldrich

Anti-MEF2C antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-Myocyte-specific enhancer factor 2C antibody produced in rabbit

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.43

생물학적 소스

rabbit

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation

기술

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
western blot: 0.04-0.4 μg/mL

면역원 서열

PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... MEF2C(4208)

일반 설명

MEF2C (myocyte enhancer factor 2C) belongs to Myocyte enhancer factor 2 (MEF2) protein family, which in turn belongs to a family of transcriptional regulators called MADS (MCMI, agamous, deficiens, serum response factor)-box. Four different forms of MEF2 protein are found in vertebrates, namely, MEF2A, MEF2B, MEF2C, and MEF2D. MEF2C is predominantly expressed in brain and skeletal muscle. It shares the common DNA-binding and dimerization domain present at the N-terminal, with other MEF2 proteins. Alternative splicing produces two MEF2C variants, which lack α exon. These MEF2Cα- are ubiquitously expressed, but at a lower level than MEF2Cα+ variants. MEF2Cα- variants are also less expressed in other tissues, as opposed to brain and heart. Alternative splicing also produces either MEF2Cγ+ or MEF2Cγ- isoforms. MEF2Cγ- is the major isoform expressed in differentiating myocytes and adult tissues. MEF2C is mapped to chromosome 5q14.3.

면역원

Myocyte-specific enhancer factor 2C recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-MEF2C antibody is suitable for chromatin immunoprecipitation (ChIP).
Anti-MEF2C antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

생화학적/생리학적 작용

MEF2C (myocyte enhancer factor 2C) belongs to the family of transcription factors, which regulate gene expression in myocytes, neurons and lymphocytes. BMK1 phosphorylates and activates MEF2C. Serum also induces BMK1-induced phosphorylation of MEF2C, and thus, MEF2C plays a role in serum-dependent early gene expression via BMK1 pathway. Lipopolysaccharides produced during microbial infection activate this protein via phosphorylation by p38. This induces c-jun transcription, which plays a role in inflammation. MEF2C plays a part in neuronal differentiation, as it is expressed in cortical plate, during early development. It is also expressed in neurons having a preference to mature cerebrocortex layers II, IV and VI. MEF2C contributes to early pathogenesis of Parkinson′s disease, as the disruption of MEF2C- PGC1α pathway, leads to neuronal apoptosis due to mitochondrial dysfunction. It is a part of Wnt pathway, and hence plays a role in control of bone mass and turnover.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST79903

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

MicroRNA-21 dysregulates the expression of MEF2C in neurons in monkey and human SIV/HIV neurological disease.
Yelamanchili, S.V., et al.
Cell Death and Differentiation, e77, e77-e77 (2010)
Vittoria Infantino et al.
Gene, 531(2), 355-362 (2013-09-07)
Myocyte enhancer factor 2C (MEF2C) belongs to the MEF2 transcription factors. All products of MEF2 genes have a common amino-terminal DNA binding and dimerization domain. All four vertebrate MEF2 gene transcripts are also alternatively spliced. In the present study we
Scott D Ryan et al.
Cell, 155(6), 1351-1364 (2013-12-03)
Parkinson's disease (PD) is characterized by loss of A9 dopaminergic (DA) neurons in the substantia nigra pars compacta (SNpc). An association has been reported between PD and exposure to mitochondrial toxins, including environmental pesticides paraquat, maneb, and rotenone. Here, using
Hou-Feng Zheng et al.
Journal of medical genetics, 50(7), 473-478 (2013-04-11)
Forearm fractures affect 1.7 million individuals worldwide each year and most occur earlier in life than hip fractures. While the heritability of forearm bone mineral density (BMD) and fracture is high, their genetic determinants are largely unknown. To identify genetic
Y Kato et al.
The EMBO journal, 16(23), 7054-7066 (1998-01-31)
Big MAP kinase 1 (BMK1), also known as ERK5, is a mitogen-activated protein (MAP) kinase member whose biological role is largely undefined. We have shown previously that the activity of BMK1 in rat smooth muscle cells is up-regulated by oxidants.

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.