콘텐츠로 건너뛰기
Merck
모든 사진(11)

주요 문서

HPA003230

Sigma-Aldrich

Anti-PDIA3 antibody produced in rabbit

enhanced validation

Ab2, Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

Anti-58 kDa glucose-regulated protein antibody produced in rabbit, Anti-58 kDa microsomal protein antibody produced in rabbit, Anti-Disulfide isomerase ER-60 antibody produced in rabbit, Anti-ERp57 antibody produced in rabbit, Anti-ERp60 antibody produced in rabbit, Anti-Protein disulfide-isomerase A3 precursor antibody produced in rabbit, Anti-p58 antibody produced in rabbit

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

mouse, rat, human

향상된 검증

RNAi knockdown
orthogonal RNAseq
independent
Learn more about Antibody Enhanced Validation

기술

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:2500-1:5000

면역원 서열

PTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYDDNGEGIILFRPSHLTNKFEDK

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... PDIA3(2923)

유사한 제품을 찾으십니까? 방문 제품 비교 안내

일반 설명

PDIA3 (protein disulfide isomerase family A, member 3) is a multi-functional protein, which belongs to the protein-disulfide isomerase family. It is thought to be a membrane receptor for 1,25-dihydroxyvitamin D3 (1α,25(OH)2D3), and is localized to endoplasmic reticulum, nucleus, plasma membrane and extracellular matrix.

면역원

Protein disulfide-isomerase A3 precursor recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-PDIA3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)
Western Blotting (1 paper)

생화학적/생리학적 작용

PDIA3 (protein disulfide isomerase family A, member 3) is believed to be a membrane receptor for 1,25(OH)2D3 that stimulates rapid membrane responses through the vitamin D receptor. In the presence of Pdia3, 1,25(OH)2D3 stimulates prostaglandin E2, protein kinase C and other membrane signaling pathways during osteoblast maturation. It stimulates cellular response to chemotherapy-induced DNA damage. The protein functions as a disulfide isomerase protein that associates with lectin chaperones calreticulin and calnexin to mediate folding of glycoproteins. It is found to be secreted in the early stages of renal fibrosis.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST86567

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Natalia F Krynetskaia et al.
Molecular cancer therapeutics, 8(4), 864-872 (2009-04-18)
The identification of new molecular components of the DNA damage signaling cascade opens novel avenues to enhance the efficacy of chemotherapeutic drugs. High-mobility group protein 1 (HMGB1) is a DNA damage sensor responsive to the incorporation of nonnatural nucleosides into
Hassan Dihazi et al.
Journal of cell science, 126(Pt 16), 3649-3663 (2013-06-20)
Renal fibrosis is characterized by excessive accumulation of extracellular matrix (ECM), which compromises organ function by replacing normal organ tissue. The molecular mechanisms leading to renal fibrosis are not fully understood. Here we demonstrated that TGFβ1, AGT or PDGF stimulation
Annika Möller-Kerutt et al.
Life science alliance, 6(3) (2022-12-23)
Crumbs2 (CRB2) is a central component of the renal filtration barrier and part of the slit diaphragm, a unique cell contact formed by glomerular podocytes. Some CRB2 variants cause recessive inherited forms of steroid-resistant nephrotic syndrome. However, the disease-causing potential
Huixing Feng et al.
PloS one, 9(4), e95621-e95621 (2014-04-26)
Proteomics study was performed to investigate the specific protein expression profiles of HepG2 cells transfected with mutant HBV compared with wildtype HBV genome, aiming to identify the specific functions of SH3 binding domain (proline rich region) located in HBx. In
Jiaxuan Chen et al.
The Journal of biological chemistry, 285(47), 37041-37050 (2010-09-17)
Protein-disulfide isomerase-associated 3 (Pdia3) is a multifunctional protein hypothesized to be a membrane receptor for 1,25(OH)(2)D(3). In intestinal epithelium and chondrocytes, 1,25(OH)(2)D(3) stimulates rapid membrane responses that are different from genomic effects via the vitamin D receptor (VDR). In this

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.