콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV54780

Sigma-Aldrich

Anti-LOXL1 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-LOL, Anti-LOXL, Anti-Lysyl oxidase-like 1

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

63 kDa

종 반응성

guinea pig, mouse, rat, human

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... LOXL1(4016)

면역원

Synthetic peptide directed towards the N terminal region of human LOXL1

애플리케이션

Anti-LOXL1 antibody produced in rabbit is suitable for western blotting at a concentration of 1μg/mL.

생화학적/생리학적 작용

The encoded protein belongs to lysyl oxidase gene family and is mapped on to chromosome 15 at 15q24-q25. It is an extracellular protein with elastin and collagen as the chief substrates. It plays a crucial role in oxidizing the epsilon (ε) amino group in lysine to produce an aldehyde group. Lysyl oxidases are copper amine oxidases that facilitate the biogenesis of connective tissue by initiating the covalent crosslinking between collagens and elastin. Defect in LOXL1 gene expression is associated with exfoliation disease development.

서열

Synthetic peptide located within the following region: RWRQLIQWENNGQVYSLLNSGSEYVPAGPQRSESSSRVLLAGAPQAQQRR

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Ane Iturbide et al.
The FEBS journal, 282(9), 1768-1773 (2014-08-12)
The lysyl oxidase (LOX) family of proteins (LOX and LOXL1-LOXL4) oxidize amino groups located in the ε-position in lysines to generate an aldehyde group. In general, they are considered as extracellular proteins and have elastin and collagen as their main
Janey L Wiggs et al.
Journal of glaucoma, 23(8 Suppl 1), S62-S63 (2014-10-03)
Variants in LOXL1 are significantly associated with exfoliation syndrome (XFS), however the impact of the associated variants on disease development is not yet understood. Initially the associated missense changes, R141L and G153D, were considered to be pathogenic alleles. Flipping of
K Kenyon et al.
The Journal of biological chemistry, 268(25), 18435-18437 (1993-09-05)
A novel human cDNA with a predicted protein homologous to the carboxyl end of lysyl oxidase, an extracellular enzyme involved in the maturation of collagen and elastin, has been isolated. The homology to lysyl oxidase begins exactly at the position
T Tadmor et al.
American journal of hematology, 88(5), 355-358 (2013-03-16)
Myeloproliferative neoplasms (MPNs) are malignant disorders originating from clonal expansion of a single neoplastic stem cell and characteristically show an increase in bone marrow reticulin fibers. Lysyl oxidases (LOXs) are copper-dependent amine oxidases that play a critical role in the

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.