추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
37 kDa
종 반응성
human, rat, mouse
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... B3GALT6(126792)
면역원
Synthetic peptide directed towards the N terminal region of human B3GALT6
애플리케이션
Anti-B3GALT6 (AB1) antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
생화학적/생리학적 작용
UDP-Gal:betaGal beta 1,3-galactosyltransferase polypeptide 6 (B3GALT6; EDSP2; SEMDJL1) catalyzes the transfer of galactose from UDP-galactose to substrates containing a terminal β-linked galactose moiety. It is localized to Golgi apparatus and is required for glycosaminoglycan synthesis. Aberrations in B3GALT6 gene result in skeletal and connective tissue disorders, collectively known as Ehlers-Danlos syndrome.
서열
Synthetic peptide located within the following region: EREQARHGDLLLLPALRDAYENLTAKVLAMLAWLDEHVAFEFVLKADDDS
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Fransiska Malfait et al.
American journal of human genetics, 92(6), 935-945 (2013-05-15)
Proteoglycans are important components of cell plasma membranes and extracellular matrices of connective tissues. They consist of glycosaminoglycan chains attached to a core protein via a tetrasaccharide linkage, whereby the addition of the third residue is catalyzed by galactosyltransferase II
Masahiro Nakajima et al.
American journal of human genetics, 92(6), 927-934 (2013-05-15)
Proteoglycans (PGs) are a major component of the extracellular matrix in many tissues and function as structural and regulatory molecules. PGs are composed of core proteins and glycosaminoglycan (GAG) side chains. The biosynthesis of GAGs starts with the linker region
X Bai et al.
The Journal of biological chemistry, 276(51), 48189-48195 (2001-09-12)
A family of five beta1,3-galactosyltransferases has been characterized that catalyze the formation of Galbeta1,3GlcNAcbeta and Galbeta1,3GalNAcbeta linkages present in glycoproteins and glycolipids (beta3GalT1, -2, -3, -4, and -5). We now report a new member of the family (beta3GalT6), involved in
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.