콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

AV49223

Sigma-Aldrich

Anti-MAP3K2 antibody produced in rabbit

affinity isolated antibody

동의어(들):

Anti-MEKK2, Anti-MEKK2B, Anti-Mitogen-activated protein kinase kinase kinase 2

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

70 kDa

종 반응성

pig, dog, human, bovine

농도

0.5 mg - 1 mg/mL

기술

western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... MAP3K2(10746)

면역원

Synthetic peptide directed towards the N terminal region of human MAP3K2

애플리케이션

Anti-MAP3K2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

생화학적/생리학적 작용

MAP Kinase Kinase Kinase 2 (MAP3K2; MEKK2) belongs to a family of enzymes that activates their substrate by dual phosphorylation at serine and threonine residues. MAP3K2 activates the kinases involved in the MAPK signaling pathway. It activates Iκ B kinases that are important regulators of NF-κB pathway. This kinase also facilitates cross-talk between c- Jun and FAK and MAPK and activates several downstream targets that contribute to cell proliferation, inflammation apoptosis and motility.

서열

Synthetic peptide located within the following region: AERKKRLSIIGPTSRDRSSPPPGYIPDELHQVARNGSFTSINSEGEFIPE

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Ahmed A Mirza et al.
Biochimica et biophysica acta, 1843(5), 945-954 (2014-02-05)
MEK Kinase 2 (MEKK2) is a serine/threonine kinase that functions as a MAPK kinase kinase (MAP3K) to regulate activation of Mitogen-activated Protein Kinases (MAPKs). We recently have demonstrated that ablation of MEKK2 expression in invasive breast tumor cells dramatically inhibits
M R Cronan et al.
Oncogene, 31(34), 3889-3900 (2011-12-06)
Analysis of patient tumors suggests that multiple MAP3 kinases (MAP3Ks) are critical for growth and metastasis of cancer cells. MAP3Ks selectively control the activation of extracellular signal-regulated kinase 1/2 (ERK1/2), Jun N-terminal kinase (JNK), p38 and ERK5 in response to
Deepa R Hammaker et al.
Journal of immunology (Baltimore, Md. : 1950), 172(3), 1612-1618 (2004-01-22)
The mitogen-activated protein kinase (MAPK) c-Jun N-terminal kinase (JNK) is a critical regulator of collagenase-1 production in rheumatoid arthritis (RA). The MAPKs are regulated by upstream kinases, including MAPK kinases (MAPKKs) and MAPK kinase kinases (MAP3Ks). The present study was
Hong Jiang et al.
Cancer immunology research, 2(8), 789-799 (2014-05-08)
Aberrant microRNA (miRNA) expression has been identified in various human solid cancers. However, whether the levels of miRNA expression in tumor cells have any effect on tumor progression has not been determined. In this proof-of-concept study, the restoration of high-level
Magdalene Ameka et al.
The Biochemical journal, 464(1), 99-108 (2014-09-06)
The intracellular kinase MEKK2 (mitogen-activated protein kinase/extracellular-signal-regulated kinase kinase kinase 2) is an upstream regulator of JNK (c-Jun N-terminal kinase), but additional functions for MEKK2 have not been well defined. Silencing MEKK2 expression in invasive breast tumour cells markedly inhibits

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.