콘텐츠로 건너뛰기
Merck
모든 사진(9)

주요 문서

HPA001401

Sigma-Aldrich

Anti-SOD1 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

동의어(들):

SOD1 Antibody - Anti-SOD1 antibody produced in rabbit, Sod1 Antibody, Anti-Superoxide dismutase [Cu-Zn] antibody produced in rabbit

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
인간 단백질 도해서 번호:
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

affinity isolated antibody

항체 생산 유형

primary antibodies

클론

polyclonal

제품 라인

Prestige Antibodies® Powered by Atlas Antibodies

양식

buffered aqueous glycerol solution

종 반응성

human

향상된 검증

RNAi knockdown
orthogonal RNAseq
Learn more about Antibody Enhanced Validation

기술

immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:1000-1:2500

면역원 서열

PVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDNTAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDSVISLSGDHCIIGRTLVVHEKADDLGKGGNEESTKTGNAGSRLACG

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... SOD1(6647)

일반 설명

Superoxide dismutase 1 (SOD 1), also called Cu-Zn superoxide dismutase, is a cytosolic protein. It is expressed as five isoforms by alternate splicing. SOD1 is mapped to human chromosome 21q22.11. It exists as a homodimer with intrasubunit disulfide bonds.

면역원

Superoxide dismutase [Cu-Zn] recombinant protein epitope signature tag (PrEST)

애플리케이션

Anti-SOD1 antibody produced in rabbit has been used in:
  • immunoprecipitation of ventral horn of spinal cords samples
  • immunocytochemistry of motor neuron and astrocyte cells
  • immunohistochemical studies of liver specimens

Anti-SOD1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

생화학적/생리학적 작용

SOD1 (superoxide dismutase 1) gene encodes an enzyme that destroys harmful free superoxide radicals in the body to molecular oxygen and hydrogen peroxide. It binds copper and zinc ions. This isozyme is a cytoplasmic homodimer. Defects in this gene have been associated with familial amyotrophic lateral sclerosis that affects upper motor neurons in the brain and lower motor neurons in the brain stem and spinal cord, resulting in fatal paralysis.

특징 및 장점

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

결합

Corresponding Antigen APREST83054

물리적 형태

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

법적 정보

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable

개인 보호 장비

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Shyh-Ming Yang et al.
Journal of medicinal chemistry, 61(11), 4883-4903 (2018-05-17)
Aldehyde dehydrogenases (ALDHs) are responsible for the metabolism of aldehydes (exogenous and endogenous) and possess vital physiological and toxicological functions in areas such as CNS, inflammation, metabolic disorders, and cancers. Overexpression of certain ALDHs (e.g., ALDH1A1) is an important biomarker
Multiple transcripts of the human Cu, Zn superoxide dismutase gene
Hirano M, et al.
Biochemical and Biophysical Research Communications, 276(1), 52-56 (2000)
Aberrant association of misfolded SOD1 with Na+/K+ ATPase-alpha3 impairs its activity and contributes to motor neuron vulnerability in ALS
Ruegsegger C, et al.
Acta Neuropathologica, 131(3), 427-451 (2016)
Caffeine intake decreases oxidative stress and inflammatory biomarkers in experimental liver diseases induced by thioacetamide: Biochemical and histological study
Amer MG, et al.
International Journal of Immunopathology and Pharmacology, 30(1), 13-24 (2017)
SOD1 transcriptional and posttranscriptional regulation and its potential implications in ALS
Milani P, et al.
Neurology research international, 2011`, 52-56 (2011)

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.