AV49134
Anti-SULT1A1 antibody produced in rabbit
affinity isolated antibody
동의어(들):
Anti-HAST1/HAST2, Anti-MGC131921, Anti-MGC5163, Anti-P-PST, Anti-PST, Anti-ST1A3, Anti-STP, Anti-Sulfotransferase family, cytosolic, 1A, phenol-preferRing, member 1
로그인조직 및 계약 가격 보기
모든 사진(4)
About This Item
UNSPSC 코드:
12352203
NACRES:
NA.41
추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
34 kDa
종 반응성
human, horse, rabbit, bovine
농도
0.5 mg - 1 mg/mL
기술
immunohistochemistry: suitable
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SULT1A1(6817)
면역원
Synthetic peptide directed towards the N terminal region of human SULT1A1
애플리케이션
Anti-SULT1A1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.
Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)
Western Blotting (1 paper)
생화학적/생리학적 작용
Sulfotransferase family, cytosolic, 1A, phenol-preferring, member 1 (SULT1A1) is a phenol sulfotransferase with thermostable activity. The members of sulfotransferase family localize to cytoplasm and catalyze the sulfate conjugation of hormones, xenobiotic compounds, drugs and neurotransmitters.
서열
Synthetic peptide located within the following region: ELIQDTSRPPLEYVKGVPLIKYFAEALGPLQSFQARPDDLLISTYPKSGT
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
M W H Coughtrie
The pharmacogenomics journal, 2(5), 297-308 (2002-11-20)
Members of the cytosolic sulfotransferase (SULT) superfamily catalyse the sulfation of a multitude of xenobiotics, hormones and neurotransmitters. Humans have at least 10 functional SULT genes, and a number of recent advances reviewed here have furthered our understanding of SULT
Philip M Probert et al.
Toxicology letters, 243, 98-110 (2016-01-08)
Rat B-13 progenitor cells are readily converted into functional hepatocyte-like B-13/H cells capable of phase I cytochrome P450-dependent activation of pro-carcinogens and induction of DNA damage. The aim of the present study was to investigate whether the cells are also
S J Hebbring et al.
Cytogenetic and genome research, 123(1-4), 205-210 (2008-01-01)
Pharmacogenetics is the study of the role of inheritance in variation to drug response. Drug response phenotypes can vary from adverse drug reactions at one end of the spectrum to equally serious lack of the desired effect of drug therapy
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.