추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
82 kDa
종 반응성
dog, human, mouse, rabbit, rat, pig
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... NCAPH(23397)
면역원
Synthetic peptide directed towards the C terminal region of human NCAPH
애플리케이션
Anti-NCAPH antibody produced in rabbit is suitable for western blotting at a concentration of 0.25μg/ml.
생화학적/생리학적 작용
NCAPH (Non-SMC condensin I complex, subunit H) also referred to as HCAP-H, BRRN1 or CAPH belongs to barr gene family and is a regulatory subunit of the condensin complex. It facilitates the conversion of interphase chromatin into mitotic-like condense chromosomes. Caspase-3 gets stimulated and cleaves Cap-H, a subunit of condensin I during prolonged mitotic arrest. This leads to a loss of condensin I complex at the chromosomes and alters the chromosomal integrity. Subsequently DNA fragmentation occurs by caspase-activated Dnase (CAD) that drives the cell towards mitotic death. Additionally, it facilitates for the structural integrity of centromeric heterochromatin during mitosis.
서열
Synthetic peptide located within the following region: TKDLQRSLPPVMAQNLSIPLAFACLLHLANEKNLKLEGTEDLSDVLVRQG
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Raquel A Oliveira et al.
Molecular and cellular biology, 25(20), 8971-8984 (2005-10-04)
During cell division, chromatin undergoes structural changes essential to ensure faithful segregation of the genome. Condensins, abundant components of mitotic chromosomes, are known to form two different complexes, condensins I and II. To further examine the role of condensin I
S-K Lai et al.
Cell death and differentiation, 18(6), 996-1004 (2010-12-15)
Mitotic death is a major form of cell death in cancer cells that have been treated with chemotherapeutic drugs. However, the mechanisms underlying this form of cell death is poorly understood. Here, we report that the loss of chromosome integrity
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.