추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
IgG fraction of antiserum
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
37 kDa
종 반응성
guinea pig, human, mouse, rat, bovine, rabbit, horse
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... SLC7A8(23428)
면역원
Synthetic peptide directed towards the middle region of human SLC7A8
애플리케이션
Anti-SLC7A8 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.
생화학적/생리학적 작용
SLC7A8 also referred to as LAT2 is an L-type neutral amino acid transporter present in the epithelium of kidney proximal tubules and the digestive tract. LAT2 preferentially selects branched-chain amino acids as substrates and transports them across membranes. It has been reported that LAT2 activates the pathway mediated by mammalian target of rapamycin complex 1 (mTORC1) in the glomerular epithelial cells and has a role in the pathogenesis of crescentic glomerulonephritis.
서열
Synthetic peptide located within the following region: PRAIFISIPLVTFVYVFANVAYVTAMSPQELLASNAVAVTFGEKLLGVMA
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Jonas Zaugg et al.
Journal of cellular and molecular medicine, 24(21), 12681-12693 (2020-10-02)
The placenta supplies the foetus with critical nutrients such as essential amino acids (AA, eg leucine) for development and growth. It also represents a cellular barrier which is formed by a polarized, differentiated syncytiotrophoblast (STB) monolayer. Active Na+ -independent leucine
Caroline Moret et al.
American journal of physiology. Renal physiology, 292(2), F555-F566 (2006-09-28)
The kidney plays a major role in acid-base homeostasis by adapting the excretion of acid equivalents to dietary intake and metabolism. Urinary acid excretion is mediated by the secretion of protons and titratable acids, particularly ammonia. NH(3) is synthesized in
Ryota Kurayama et al.
Laboratory investigation; a journal of technical methods and pathology, 91(7), 992-1006 (2011-03-16)
Molecular mechanisms and signaling pathways leading to cellular proliferation and lesion formation in the crescentic glomerulonephritis (CGN) remain elusive. In the present study we have explored a potential role of the mammalian target of rapamycin complex 1 (mTORC1) signaling pathway
Sun Young Park et al.
Archives of pharmacal research, 28(4), 421-432 (2005-05-28)
In order to understand the renal reabsorption mechanism of neutral amino acids via amino acid transporters, we have isolated human L-type amino acid transporter 2 (hLAT2) and human T-type amino acid transporter 1 (hTAT1) in human, then, we have examined
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.