콘텐츠로 건너뛰기
Merck
모든 사진(2)

주요 문서

AV32880

Sigma-Aldrich

Anti-PPARG (AB1) antibody produced in rabbit

IgG fraction of antiserum

동의어(들):

Anti-Peroxisome proliferator-activated receptor γ

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

결합

unconjugated

항체 형태

IgG fraction of antiserum

항체 생산 유형

primary antibodies

클론

polyclonal

양식

buffered aqueous solution

분자량

56 kDa

종 반응성

rabbit, rat, mouse, horse, guinea pig, human, dog

농도

0.5 mg - 1 mg/mL

기술

immunohistochemistry: suitable
western blot: suitable

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

저장 온도

−20°C

타겟 번역 후 변형

unmodified

유전자 정보

human ... PPARG(5468)

일반 설명

Peroxisome proliferator-activated receptor gamma/glitazone receptor (PPARG, NR1C3) is a type II nuclear receptor involved in the regulation of fatty acid storage and glucose metabolism. PPARG activation stimulates lipid uptake and adipocyte differention/adipogenesis. PPARG is a component of pathologies such as diabetes, atherosclerosis, and cancer. PPARG helps regulate the inflammatory response of endothelial cells.
Rabbit polyclonal anti-PPARG (AB1) antibody reacts with bovine, canine, human, mouse, rat, chicken, rabbit, and pig peroxisome proliferator-activated receptor gamma/glitazone receptors.

면역원

Synthetic peptide directed towards the N terminal region of human PPARG

애플리케이션

Rabbit Anti-PPARG has been used at a dilution of 1:50 for IHC applications. It can also be used for western blot at 1.25 μg/ml.
Rabbit polyclonal anti-PPARG (AB1) antibody is used to tag peroxisome proliferator-activated receptor gamma/glitazone for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of peroxisome proliferator-activated receptor gamma/glitazone receptor in lipid and glucose metabolism, adipocyte differentiation and potential associated diseases such as diabetes, atherosclerosis, and cancer.

생화학적/생리학적 작용

PPARG is a regulator of adipocyte differentiation. Additionally, PPAR-gamma has been implicated in the pathology of numerous diseases including obesity, diabetes, atherosclerosis and cancer.

서열

Synthetic peptide located within the following region: SHSFDIKPFTTVDFSSISTPHYEDIPFTRTDPVVADYKYDLKLQEYQSAI

물리적 형태

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

10 - Combustible liquids

WGK

WGK 3

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


가장 최신 버전 중 하나를 선택하세요:

시험 성적서(COA)

Lot/Batch Number

적합한 버전을 찾을 수 없으신가요?

특정 버전이 필요한 경우 로트 번호나 배치 번호로 특정 인증서를 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

Jonathan Rakar et al.
Differentiation; research in biological diversity, 84(4), 305-313 (2012-10-02)
Autologous cell-based therapies promise important developments for reconstructive surgery. In vitro expansion as well as differentiation strategies could provide a substantial benefit to cellular therapies. Human dermal fibroblasts, considered ubiquitous connective tissue cells, can be coaxed towards different cellular fates
Aneta A Koronowicz et al.
PPAR research, 2017, 2865283-2865283 (2017-05-02)
In our previous study, we showed that fatty acids from CLA-enriched egg yolks (EFA-CLA) reduced the proliferation of breast cancer cells; however, the molecular mechanisms of their action remain unknown. In the current study, we used MCF-7 breast cancer cell

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.