추천 제품
생물학적 소스
rabbit
Quality Level
결합
unconjugated
항체 형태
affinity isolated antibody
항체 생산 유형
primary antibodies
클론
polyclonal
양식
buffered aqueous solution
분자량
33 kDa
종 반응성
rat, human, bovine, guinea pig, rabbit
농도
0.5 mg - 1 mg/mL
기술
western blot: suitable
NCBI 수납 번호
UniProt 수납 번호
배송 상태
wet ice
저장 온도
−20°C
타겟 번역 후 변형
unmodified
유전자 정보
human ... ZBTB32(27033)
일반 설명
ZBTB32 is a zinc-finger protein that can repress the expression of CIITA and MHC II genes during B cell differentiation.
Rabbit Anti-ZBTB32 recognizes bovine, mouse, canine, and human ZBTB32.
Rabbit Anti-ZBTB32 recognizes bovine, mouse, canine, and human ZBTB32.
면역원
Synthetic peptide directed towards the N terminal region of human ZBTB32
애플리케이션
Rabbit Anti-ZBTB32 antibody can be used for western blot applications at a concentration of 0.5μg/ml.
생화학적/생리학적 작용
ZBTB32 may play an essential role during the proliferative stages of primitive hematopoietic progenitors, possibly acting in concert with (a subset of) the Fanconi anemia proteins. This gene can also interact with GATA-2 and can modify GATA-2 transactivation capacity.
서열
Synthetic peptide located within the following region: PIRLPSPYGSDRLVQLAARLRPALCDTLITVGSQEFPAHSLVLAGVSQQL
물리적 형태
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
면책조항
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
적합한 제품을 찾을 수 없으신가요?
당사의 제품 선택기 도구.을(를) 시도해 보세요.
Storage Class Code
10 - Combustible liquids
WGK
WGK 3
Flash Point (°F)
Not applicable
Flash Point (°C)
Not applicable
가장 최신 버전 중 하나를 선택하세요:
Hye Suk Yoon et al.
Journal of immunology (Baltimore, Md. : 1950), 189(5), 2393-2403 (2012-08-02)
CIITA and MHC class II expression is silenced during the differentiation of B cells to plasma cells. When B cell differentiation is carried out ex vivo, CIITA silencing occurs rapidly, but the factors contributing to this event are not known.
자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..
고객지원팀으로 연락바랍니다.