콘텐츠로 건너뛰기
Merck
모든 사진(1)

주요 문서

06-596

Sigma-Aldrich

Anti-STAT3 Antibody

Upstate®, from rabbit

동의어(들):

Acute-phase response factor, DNA-binding protein APRF, signal transducer and activator of transcription, signal transducer and activator of transcription, (acute-phase response factor)

로그인조직 및 계약 가격 보기


About This Item

UNSPSC 코드:
12352203
eCl@ss:
32160702
NACRES:
NA.41

생물학적 소스

rabbit

Quality Level

항체 형태

purified immunoglobulin

항체 생산 유형

primary antibodies

클론

polyclonal

종 반응성

mouse, human, rat

제조업체/상표

Upstate®

기술

ChIP: suitable
electrophoretic mobility shift assay: suitable
immunocytochemistry: suitable
immunoprecipitation (IP): suitable
western blot: suitable

동형

IgG

NCBI 수납 번호

UniProt 수납 번호

배송 상태

wet ice

타겟 번역 후 변형

unmodified

유전자 정보

human ... STAT3(6774)
mouse ... Stat3(20848)

일반 설명

STAT proteins (Signal Transduction and Activators of Transcription) are latent cytoplasmic transcription factors that have the dual function of signal transduction and activation of transcription. STATs are activated by tyrosine phosphorylation in response to different ligands, after which they translocate to the cell nucleus. The N-terminal region is highly homologous among the STAT proteins and surrounds a completely conserved arginine residue. STATs are a part of the JAK-STAT signaling pathway – a major pathway of the immune system. All cytokines transduce critical signals through this pathway. STAT3 has been shown to be activated by IFN alpha but not IFN beta. The transcription factors associated with STAT3 are cJun and cyclic AMP responsive enhancer binding protein (CREB). Deletion of the STAT3 gene in knock out mice was lethal at the early embryonic stage.

특이성

Recognizes STAT3, Mr 92 kDa. Additional unknown bands may be detected.

면역원

Bacterially expressed GST fusion protein corresponding to a.a. 688-722 of human STAT 3 (RPESQEHPEADPGSAAPYLKTKFICVTPTTCSNTI). The immunizing sequence is identical in mouse and rat STAT3. The first 28 amino acids are identical to mouse STAT3B.
Epitope: a.a. 688-722

애플리케이션

Anti-STAT3 Antibody is a Rabbit Polyclonal Antibody for detection of STAT3 also known as Acute-phase response factor or DNA-binding protein APRF & has been validated in ChIP, EMSA, ICC, IP & WB.
Immunoprecipitation:
4 μg of a previous lot immunoprecipitated STAT3 from 500 μg of EGF-stimulated A431 RIPA lysate.
Gel Shift Assay:
An independent laboratory has reported that this antibody supershifts.
Immunocytochemistry:
10 μg/mL of a previous lot of this antibody showed positive immunostaining for STAT3 in A431 cells fixed with 95% ethanol, 5% acetic acid.
Research Category
Epigenetics & Nuclear Function
Research Sub Category
Transcription Factors

품질

Routinely evaluated by western blot on RIPA lysates from EGF stimulated human A431 cells, mouse WEHI or rat L6.

Western Blot Analysis:
0.5-2 μg/mL of this lot detected STAT3 in RIPA lysates from EGF stimulated human A431 cells and previously from mouse WEHI and rat L6.

표적 설명

92 kDa

결합

Replaces: 04-1014

물리적 형태

Format: Purified
Protein A purified
Protein A purified rabbit IgG in 200 L of 0.1 M Tris-glycine, pH 7.4, 0.15 M NaCl, 0.05% sodium azide. Frozen at -20°C.

저장 및 안정성

Stable for 1 year at -20°C from date of receipt.
Handling Recommendations: Upon first thaw, and prior to removing the cap, centrifuge the vial and gently mix the solution. Aliquot into microcentrifuge tubes and store at -20°C. Avoid repeated freeze/thaw cycles, which may damage IgG and affect product performance.

분석 메모

Control
Positive Antigen Control: Catalog #12-302, EGF-stimulated A431 cell lysate. Add 2.5µL of 2-mercaptoethanol/100µL of lysate and boil for 5 minutes to reduce the preparation. Load 20µg of reduced lysate per lane for minigels.

기타 정보

Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.

법적 정보

UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany

면책조항

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

적합한 제품을 찾을 수 없으신가요?  

당사의 제품 선택기 도구.을(를) 시도해 보세요.

Storage Class Code

12 - Non Combustible Liquids

WGK

WGK 1

Flash Point (°F)

Not applicable

Flash Point (°C)

Not applicable


시험 성적서(COA)

제품의 로트/배치 번호를 입력하여 시험 성적서(COA)을 검색하십시오. 로트 및 배치 번호는 제품 라벨에 있는 ‘로트’ 또는 ‘배치’라는 용어 뒤에서 찾을 수 있습니다.

이 제품을 이미 가지고 계십니까?

문서 라이브러리에서 최근에 구매한 제품에 대한 문서를 찾아보세요.

문서 라이브러리 방문

The box-1 region of the leukemia inhibitory factor receptor alpha-chain cytoplasmic domain is sufficient for hemopoietic cell proliferation and differentiation
Zhang, Y., et al
The Journal of Biological Chemistry, 273, 34370-34383 (1998)
IL-5 and granulocyte-macrophage colony-stimulating factor activate STAT3 and STAT5 and promote Pim-1 and cyclin D3 protein expression in human eosinophils.
Barbara A Stout, Mary Ellen Bates, Lin Ying Liu, Natasha N Farrington, Paul J Bertics
Journal of immunology (Baltimore, Md. : 1950) (1950)
Glutamine Deprivation Causes Hydrogen Peroxide-induced Interleukin-8 Expression via Jak1/Stat3 Activation in Gastric Epithelial AGS Cells.
Lee, YM; Kim, MJ; Kim, Y; Kim, H
Journal of cancer prevention null
M Ernst et al.
The Journal of biological chemistry, 274(14), 9729-9737 (1999-03-27)
Cell type-specific responses to the leukemia inhibitory factor (LIF)/interleukin 6 cytokine family are mediated by dimerization of the LIF receptor alpha-chain (LIFRalpha) with the signal transducer gp130 or of two gp130 molecules followed by activation of the JAK/STAT and Ras/mitogen-activated
Differentiation of oligodendroglial progenitors derived from cortical multipotent cells requires extrinsic signals including activation of gp130/LIFbeta receptors
Marmur, R., et al
The Journal of Neuroscience, 18, 9800-9811 (1998)

자사의 과학자팀은 생명 과학, 재료 과학, 화학 합성, 크로마토그래피, 분석 및 기타 많은 영역을 포함한 모든 과학 분야에 경험이 있습니다..

고객지원팀으로 연락바랍니다.