Accéder au contenu
MilliporeSigma
Toutes les photos(4)

Principaux documents

WH0084444M1

Sigma-Aldrich

Monoclonal Anti-DOT1L antibody produced in mouse

clone 6A6, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-DOT1, Anti-DOT1-like, histone H3 methyltransferase (S. cerevisiae), Anti-KIAA1814

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(4)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

6A6, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunofluorescence: suitable
indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG1κ

Numéro d'accès GenBank

NM_032482

Numéro d'accès UniProt

Q8TEK3

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... DOT1L(84444)

Description générale

Disruptor of telomeric silencing 1 (DOT1) like histone lysine methyltransferase (DOT1L) is encoded by the gene mapped to human chromosome 19p13.3.

Immunogène

DOT1L (NP_115871, 3 a.a. ~ 108 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
EKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSTGLLR

Actions biochimiques/physiologiques

Disruptor of telomeric silencing 1 (DOT1) like histone lysine methyltransferase (DOT1L), is a nucleosomal enzyme that catalyzes the intra-nucleosomal methylation of H3 at lysine-79, a crucial step involved in the regulation of cell cycle, transcriptional regulation, and DNA damage response. Mammalian DOT1 gene plays an essential role in embryogenesis, hematopoiesis, cardiac function, and development of leukemia. Thus, DOT1L can act as a potential target for therapeutic treatment of the same. Elevated DOT1L enzymatic activity leads to MLL (mixed-lineage leukemia). Therefore, inhibition of DOT1L by SYC-522 in combination with DNA-damaging chemotherapy is considered as a potential treatment for MLL.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

nwg

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
06244-6A6

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Anh Tram Nguyen et al.
Genes & development, 25(13), 1345-1358 (2011-07-05)
DOT1 (disruptor of telomeric silencing; also called Kmt4) was initially discovered in budding yeast in a genetic screen for genes whose deletion confers defects in telomeric silencing. Since the discovery ∼10 years ago that Dot1 and its mammalian homolog, DOT1L
Wei Liu et al.
PloS one, 9(5), e98270-e98270 (2014-05-27)
DOT1L, the only known histone H3-lysine 79 (H3K79) methyltransferase, has been shown to be essential for the survival and proliferation of mixed-linkage leukemia (MLL) gene rearranged leukemia cells, which are often resistant to conventional chemotherapeutic agents. To study the functions
Megumi Hirokawa et al.
European journal of human genetics : EJHG, 23(3), 374-380 (2014-06-12)
Despite considerable progress in preventive and therapeutic strategies, myocardial infarction (MI) is one of the leading causes of death throughout the world. A total of 55 susceptibility genes have been identified mostly in European genome-wide association studies (GWAS). Nevertheless, large-scale

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique