Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Principaux documents

WH0005690M2

Sigma-Aldrich

Monoclonal Anti-PSMB2 antibody produced in mouse

clone M1, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-HC7I, Anti-MGC104215, Anti-MGC126885, Anti-proteasome (prosome, macropain) subunit, beta type, 2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

M1, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable
indirect ELISA: suitable

Isotype

IgG1κ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... PSMB2(5690)

Description générale

The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the proteasome B-type family, also known as the T1B family, that is a 20S core beta subunit. (provided by RefSeq)

Immunogène

PSMB2 (AAH00268, 1 a.a. ~ 201 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEYLIGIQGPDYVLVASDRVAASNIVQMKDDHDKMFKMSEKILLLCVGEAGDTVQFAEYIQKNVQLYKMRNGYELSPTAAANFTRRNLADCLRSRTPYHVNLLLAGYDEHEGPALYYMDYLAALAKAPFAAHGYGAFLTLSILDRYYTPTISRERAVELLRKCLEELQKRFILNLPTFSVRIIDKNGIHDLDNISFPKQGS

Actions biochimiques/physiologiques

Proteasome subunit β 2 (PSMB2) has a trypsin-like activity. It has a role in double-strand break repair and associates with homeobox A2 (HOXA2). Overexpression of the protein in human cells has been shown to reduce homologous recombination. It may trigger the loading of β subunit onto a rings in the proteasome.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Genetic relationships of the genes encoding the human proteasome beta subunits and the proteasome PA28 complex.
McCusker D
Genomics, 45(2), 362-367 (1997)
The over-expression of the ?2 catalytic subunit of the proteasome decreases homologous recombination and impairs DNA double-strand break repair in human cells.
Collavoli A
Journal of Biomedicine and Biotechnology, 2011, 757960-757960 (2011)
Differential intra-proteasome interactions involving standard and immunosubunits.
Jayarapu K and Griffin TA
Biochemical and Biophysical Research Communications, 358(3), 867-872 (2007)
The homeodomain transcription factor Hoxa2 interacts with and promotes the proteasomal degradation of the E3 ubiquitin protein ligase RCHY1.
Bergiers L
PLoS ONE, 8(11), e80387-e80387 (2013)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique