Accéder au contenu
MilliporeSigma
Toutes les photos(6)

Principaux documents

WH0000475M1

Sigma-Aldrich

Monoclonal Anti-ATOX1 antibody produced in mouse

clone 2E6, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

Anti-ATX1, Anti-ATX1 antioxidant protein 1 homolog (yeast), Anti-HAH1, Anti-MGC138453, Anti-MGC138455

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

2E6, monoclonal

Forme

buffered aqueous solution

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Isotype

IgG2aκ

Numéro d'accès GenBank

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... ATOX1(475)

Description générale

This gene encodes a copper chaperone that plays a role in copper homeostasis by binding and transporting cytosolic copper to ATPase proteins in the trans-Golgi network for later incorporation to the ceruloplasmin. This protein also functions as an antioxidant against superoxide and hydrogen peroxide, and therefore, may play a significant role in cancer carcinogenesis. Because of its cytogenetic location, this gene represents a candidate gene for 5q-syndrome. (provided by RefSeq)
ATOX1 (antioxidant 1 copper chaperone) is a metallochaperone which is also called as HAH1. It is a small cytosolic protein. ATOX1 is located on human chromosome 5q33.

Immunogène

ATOX1 (NP_004036, 1 a.a. ~ 68 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE

Application

Monoclonal Anti-ATOX1 antibody has been used in immunoblot analysis.

Actions biochimiques/physiologiques

ATOX1 (antioxidant 1 copper chaperone) participates in the human copper modulation system. It plays a major role in the migration of breast cancer cells. ATOX1 helps in the transportation of copper to the cell secretory pathway.

Caractéristiques et avantages

Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will issue a full credit or replacement antibody. Learn more.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Informations légales

GenBank is a registered trademark of United States Department of Health and Human Services

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Metallochaperone Atox1 transfers copper to the NH2-terminal domain of the Wilson's disease protein and regulates its catalytic activity.
Walker JM, et al.
The Journal of Biological Chemistry, 277(31), 27953-27959 (2002)
The structural flexibility of the human copper chaperone Atox1: Insights from combined pulsed EPR studies and computations.
Levy AR, et al.
Protein Science, 26(8), 1609-1618 (2017)
Ye-Jin Kim et al.
Metallomics : integrated biometal science, 11(8), 1430-1440 (2019-07-19)
Copper (Cu) is a tightly regulated micronutrient that functions as a structural or catalytic cofactor for specific proteins essential for a diverse array of biological processes. While the study of the extremely rare genetic diseases, Menkes and Wilson, has highlighted
Copper chaperone Atox1 plays role in breast cancer cell migration.
Blockhuys S and Wittung-Stafshede P
Biochemical and Biophysical Research Communications, 483(1), 301-304 (2017)
ATOX1 gene silencing increases susceptibility to anticancer therapy based on copper ionophores or chelating drugs.
Barresi V, et al.
Journal of Inorganic Biochemistry, 156, 145-152 (2016)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique