SAB5702476

Anti-p16-ARC/ARC16/ARPC5 Antibody, clone 7W9M7, Rabbit Monoclonal

• Synonyme(s) : ARC16, dJ127C7.3, p16-Arc
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.46

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Matériaux: colorless
• Clone: 7W9M7, monoclonal
• Forme: liquid
• Poids mol.: 18 kDa
• Espèces réactives: rat, rat, human
• Concentration: 0.625 mg/mL
• Technique(s): western blot: 1:500 - 1:2000
• Couleur: colorless
• Isotype: IgG
• Séquence immunogène: MSKNTVSSARFRKVDVDEYDENKFVDEEDGGDGQAGPDEGEVDSCLRQGNMTAALQAALKNPPINTKSQAVKDRAGSIVLKVLISFKANDIEKAVQSLDK
• Numéro d'accès UniProt: O15511
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... ARPC5(10092)

Description

Description générale

This gene encodes one of seven subunits of the human Arp2/3 protein complex. The Arp2/3 protein complex has been implicated in the control of actin polymerization in cells and has been conserved through evolution. The exact role of the protein encoded by this gene, the p16 subunit, has yet to be determined. Alternatively spliced transcript variants encoding different isoforms have been observed for this gene. [provided by RefSeq, Jul 2012]

Immunogène

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human p16-ARC/ARC16/ARPC5 (O15511).

PBS with 0.02% sodium azide,0.05% BSA,50% glycerol,pH7.3.

Application

WB

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 1