Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

SAB2104114

Sigma-Aldrich

Anti-NRARP antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-MGC61598

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

12 kDa

Espèces réactives

mouse, rat, dog, bovine, pig, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NM_001004354

Numéro d'accès UniProt

Q7Z6K4

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... NRARP(441478)

Catégories apparentées

Description générale

NRARP (NOTCH-regulated ankyrin repeat protein) works as a negative feedback regulator in Notch (neurogenic locus notch homolog protein) signaling. On the other hand, expression of NRARP is controlled by Notch protein. The protein has two ankyrin repeats.

Immunogène

Synthetic peptide directed towards the middle region of human NRARP

Actions biochimiques/physiologiques

During development, NRARP (NOTCH-regulated ankyrin repeat protein) is involved in crosstalk between NOTCH (neurogenic locus notch homolog protein) and WNT (wingless-type mouse mammary tumor virus integration site) signaling. Presence of NRARP allows proper vessel density in angiogenesis. In breast cancer, NRARP might enhances the cell proliferation. It is upregulated in thyroid cancer tissues and is associated with cell growth and invasion. It is also overexpressed in hepatocellular carcinoma tumor tissues.

Séquence

Synthetic peptide located within the following region: QNMTNCEFNVNSFGPEGQTALHQSVIDGNLELVKLLVKFGADIRLANRDG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
QC27089

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Nrarp coordinates endothelial Notch and Wnt signaling to control vessel density in angiogenesis.
Phng LK, et al.
Developmental Cell, 16, 70-82 (2009)
Overexpression of NOTCH-regulated ankyrin repeat protein is associated with breast cancer cell proliferation.
Imaoka T, et al.
Anticancer Research, 34, 2165-2171 (2014)
Downregulation of Notch-regulated Ankyrin Repeat Protein Exerts Antitumor Activities against Growth of Thyroid Cancer.
Chu BF, et al.
Chinese Medical Journal (English Edition), 129, 1544-1552 (2016)
Pingping Zhu et al.
Nature communications, 6, 7122-7122 (2015-05-20)
Liver cancer stem cells (CSCs) harbour self-renewal and differentiation properties, accounting for chemotherapy resistance and recurrence. However, the molecular mechanisms to sustain liver CSCs remain largely unknown. In this study, based on analysis of several hepatocellular carcinoma (HCC) transcriptome datasets

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique