SAB2102665

Anti-UTX antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-BA386N14.2, Anti-DKFZp686A03225, Anti-MGC141941, Anti-Ubiquitously transcribed tetratricopeptide repeat, X chromosome
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 154 kDa
• Espèces réactives: mouse, human, bovine, rabbit, guinea pig, rat, dog, horse
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès UniProt: O15550
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... UTX(7403)

Description

Immunogène

Synthetic peptide directed towards the middle region of human UTX

Actions biochimiques/physiologiques

UTX is a histone demethylase that specifically demethylates ′Lys-27′ of histone H3, thereby playing a central role in histone code. It demethylates trimethylated and dimethylated but not monomethylated H3 ′Lys-27′. UTX plays a central role in regulation of posterior development, by regulating HOX gene expression. Demethylation of ′Lys-27′ of histone H3 is concomitent with methylation of ′Lys-4′ of histone H3, and regulates the recruitment of the PRC1 complex and monoubiquitination of histone H2A.

Séquence

Synthetic peptide located within the following region: KTYIVHCQDCARKTSGNLENFVVLEQYKMEDLMQVYDQFTLAPPLPSASS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable