Accéder au contenu
MilliporeSigma
Toutes les photos(3)

Principaux documents

SAB2102261

Sigma-Aldrich

Anti-SOD2 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-IPO-B, Anti-MNSOD, Anti-Superoxide dismutase 2, mitochondrial

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Poids mol.

24 kDa

Espèces réactives

bovine, sheep, rat, dog, goat, human, guinea pig, rabbit

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès UniProt

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SOD2(6648)

Immunogène

Synthetic peptide directed towards the N terminal region of human SOD2

Application

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Western Blotting (1 paper)

Séquence

Synthetic peptide located within the following region: MLSRAVCGTSRQLAPVLGYLGSRQKHSLPDLPYDYGALEPHINAQIMQLH

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Angelina Rafaela Debortoli et al.
Journal of molecular endocrinology, 59(2), 171-180 (2017-07-25)
Compared with age-matched men, premenopausal women are largely protected from coronary artery disease, a difference that is lost after menopause. The effects of oestrogens are mediated by the activation of nuclear receptors (ERα and ERβ) and by the G protein-coupled
Nathalie T B Delgado et al.
Frontiers in pharmacology, 7, 522-522 (2017-01-20)
Decline in estrogen levels promotes endothelial dysfunction and, consequently, the most prevalent cardiovascular diseases in menopausal women. The use of natural therapies such as pomegranate can change these results. Pomegranate [Punica granatum L. (Punicaceae)] is widely used as a phytotherapeutic
Xuan Xu et al.
Cardiovascular diagnosis and therapy, 10(3), 453-469 (2020-07-23)
Myocardial mitochondrial dysfunction is the leading cause of chronic heart failure (CHF). Increased reactive oxygen species (ROS) levels, disruption of mitochondrial biogenesis and mitochondrial Ca2+([Ca2+]m) homeostasis and reduction of the mitochondrial membrane potential (ΔΨm) cause myocardial mitochondrial dysfunction. Therefore, treating
Guohua Gong et al.
Journal of molecular and cellular cardiology, 76, 235-246 (2014-09-25)
The heart is an excitable organ that undergoes spontaneous force generation and relaxation cycles driven by excitation-contraction (EC) coupling. A fraction of the oscillating cytosolic Ca(2+) during each heartbeat is taken up by mitochondria to stimulate mitochondrial metabolism, the major
Kouji Komatsu et al.
Reproduction (Cambridge, England), 147(5), 627-638 (2014-01-25)
Hormonal stimulation in superovulation induces female mice to ovulate more oocytes than spontaneous ovulation. Because the superovulated oocytes contain a number of oocytes that normally regress before spontaneous ovulation or immature oocytes, the development of some embryos that derive from

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique