Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

SAB2100971

Sigma-Aldrich

Anti-GRHL1 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Grainyhead-like 1 (Drosophila), Anti-LBP-32, Anti-LBP32, Anti-MGR, Anti-TFCP2L2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

70 kDa

Espèces réactives

horse, rat, dog, mouse, human, bovine

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... GRHL1(29841)

Immunogène

Synthetic peptide directed towards the N terminal region of human GRHL1

Actions biochimiques/physiologiques

GRHL1 is a member of the grainyhead family of transcription factors. GRHL1 interacts with sister of mammalian grainyhead (SOM) and may function as a transcription factor during development. Two transcript variants encoding distinct isoforms have been identified for GRHL1.This gene encodes a member of the grainyhead family of transcription factors. The encoded protein interacts with sister of mammalian grainyhead (SOM) and may function as a transcription factor during development. Two transcript variants encoding distinct isoforms have been identified for this gene.

Séquence

Synthetic peptide located within the following region: GENRVQVLKNVPFNIVLPHGNQLGIDKRGHLTAPDTTVTVSIATMPTHSI

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique