Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Principaux documents

SAB1412548

Sigma-Aldrich

ANTI-TLR4 antibody produced in mouse

clone 4B10, purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

ARMD10, CD284, TLR4, TOLL, hToll

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

mouse

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

4B10, monoclonal

Forme

buffered aqueous solution

Poids mol.

antigen 34.32 kDa

Espèces réactives

human

Technique(s)

indirect ELISA: suitable
western blot: 1-5 μg/mL

Isotype

IgG2bκ

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... TLR4(7099)

Catégories apparentées

Description générale

The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns (PAMPs) that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor is most abundantly expressed in placenta, and in myelomonocytic subpopulation of the leukocytes. It has been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness. Also, several transcript variants of this gene have been found, but the protein coding potential of most of them is uncertain. (provided by RefSeq)
Toll like receptor 4 (TLR4) is an extracellular pathogen recognition receptor (PRR), encoded by the gene mapped to human chromosome 9q32–33. The encoded protein belongs to the interleukin-1 (IL-1)/toll receptor family and is present on both immune and nonimmune cells.

Immunogène

TLR4 (NP_612564, 214 a.a. ~ 291 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PMNFIQPGAFKEIRLHKLTLRNNFDSLNVMKTCIQGLAGLEVHRLVLGEFRNEGNLEKFDKSALEGLCNLTIEEFRLA

Actions biochimiques/physiologiques

Toll like receptor 4 (TLR4) is a bacterial lipopolysaccharide (LPS) sensor. It plays a vital role in regulation of innate immunity. Palmitic acid (PA) interacts with TLR4 to stimulate pro-inflammatory cytokine interleukin-1β (IL-1β) secretion in human immune cells. Elevated expression of TLR4 is associated with the lupus nephritis (LN) and chronic cutaneous lupus erythematosus (CLE) pathogenesis. Genetic variations in the gene has been observed in patients with esophageal adenocarcinoma (EAC).

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Toll like receptor 4 and hepatocellular carcinoma; A systematic review.
Sepehri Z
Life Sciences, 179, 80-87 (2017)
The Increased Expression of Toll-Like Receptor 4 in Renal and Skin Lesions in Lupus Erythematosus.
Elloumi N
The Journal of Histochemistry and Cytochemistry, 65(7), 389-398 (2017)
Impact of mutations in Toll-like receptor pathway genes on esophageal carcinogenesis.
Fels Elliott DR
PLoS Genetics, 13(5), 1-21 (2017)
Cutting edge: Toll-like receptor 4 (TLR4)-deficient mice are hyporesponsive to lipopolysaccharide: evidence for TLR4 as the Lps gene product.
Hoshino K
Journal of Immunology, 162(7), 3749-3752 (1999)
Palmitic acid is a toll-like receptor 4 ligand that induces human dendritic cell secretion of IL-1?.
Nicholas DA
PLoS ONE, 12(5), 1-24 (2017)

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique