Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Principaux documents

SAB1410565

Sigma-Aldrich

Anti-CYP4V2 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

BCD, CYP4AH1, FLJ18432, MGC43534

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

antigen 60.7 kDa

Espèces réactives

human

Technique(s)

western blot: 1 μg/mL

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CYP4V2(285440)

Description générale

Cytochrome P450 4V2 (CYP4V2) belongs to human cytochrome P450 enzyme family and encodes a protein of 55 kDa. CYP4V2 gene is mapped to human chromosome 4q35.1−q35.2. CYP4V2 is majorly expressed in the epithelial cells of the retina and cornea. In retinal pigment epithelia (RPE) cell lines, the enzyme is localized to endoplasmic reticulum.
This gene encodes a member of the cytochrome P450 hemethiolate protein superfamily which are involved in oxidizing various substrates in the metabolic pathway. It is implicated in the metabolism of fatty acid precursors into n-3 polyunsaturated fatty acids. Mutations in this gene result in Bietti crystalline corneoretinal dystrophy. (provided by RefSeq)

Immunogène

CYP4V2 (NP_997235.2, 1 a.a. ~ 525 a.a) full-length human protein.

Sequence
MAGLWLGLVWQKLLLWGAASALSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLVGHALLMKPDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSKQIDKSSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKHINQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSEMIFRRIKMPWLWLDLWYLMFKEGWEHKKSLKILHTFTNSVIAERANEMNANEDCRGDGRGSAPSKNKRRAFLDLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGSNPEVQKKVDHELDDVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAVIIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTILSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRNADER

Actions biochimiques/physiologiques

Cytochrome P450 4V2 (CYP4V2) is involved in the fatty acid ω-hydroxylation. It alters lipid homeostasis when expressed in human liver cancer HepG2 cells. It coordinates with enzymes involved in mitochondrial and peroxisomal α/β-oxidation. Functional CYP4V2 gene mutant is implicated in ocular disease called the Bietti crystalline dystrophy. It is also expressed in macrophages and is regulated by nuclear receptor peroxisome proliferator activated receptor γ (PPARγ).

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Expression and characterization of CYP4V2 as a fatty acid omega-hydroxylase
Nakano M, et al.
Drug Metabolism and Disposition, 37(11), 2119-2122 (2009)
Expression of CYP4V2 in human THP1 macrophages and its transcriptional regulation by peroxisome proliferator-activated receptor gamma
Yi M, et al.
Toxicology and Applied Pharmacology, 330(5), 100-106 (2017)
CYP4V2 in Bietti's crystalline dystrophy: ocular localization, metabolism of omega-3-polyunsaturated fatty acids, and functional deficit of the p. H331P variant
Nakano M, et al.
Molecular Pharmacology, 82(4), 679-686 (2012)
Erin L Heinzen et al.
American journal of human genetics, 86(5), 707-718 (2010-04-20)
Deletions at 16p13.11 are associated with schizophrenia, mental retardation, and most recently idiopathic generalized epilepsy. To evaluate the role of 16p13.11 deletions, as well as other structural variation, in epilepsy disorders, we used genome-wide screens to identify copy number variation

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique