Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

SAB1401190

Sigma-Aldrich

Anti-IAPP antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

Synonyme(s) :

AMYLIN, DAP, IAP

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.43

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

purified immunoglobulin

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Espèces réactives

human

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

dry ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... IAPP(3375)

Description générale

Islet, or insulinoma, amyloid polypeptide is commonly found in pancreatic islets of patients suffering diabetes mellitus type II, or harboring an insulinoma. While the assosciation of amylin with the development of type II diabetes has been known for some time, a direct causative role for amylin has been harder to establish. Studies suggest that amylin, like the related beta-amyloid (Abeta) associated with Alzheimer′s disease, can induce apoptotic cell-death in particular cultured cells, an effect that may be relevant to the development of type II diabetes. (provided by RefSeq)

Immunogène

IAPP (NP_000406.1, 1 a.a. ~ 89 a.a) full-length human protein.

Sequence
MGILKLQVFLIVLSVALNHLKATPIESHQVEKRKCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTYGKRNAVEVLKREPLNYLPL

Actions biochimiques/physiologiques

IAPP (islet amyloid polypeptide) is secreted by the pancreatic β-cells along with insulin. IAPP is known to be involved in the regulation of gastric emptying, satiety and inhibiting glucagon secretion. IAPP is associated with type 2 diabetes mellitus where IAPP is part of amyloid deposits and is associated with mass and functional loss of β-cells. Oligomers and fibrils formed by IAPP is known to be toxic to the pancreatic islet β-cells.

Forme physique

Solution in phosphate buffered saline, pH 7.4

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

N G Copeland et al.
Science (New York, N.Y.), 262(5130), 57-66 (1993-10-01)
Technological advances have made possible the development of high-resolution genetic linkage maps for the mouse. These maps in turn offer exciting prospects for understanding mammalian genome evolution through comparative mapping, for developing mouse models of human disease, and for identifying
Michele F M Sciacca et al.
Biophysical journal, 111(1), 140-151 (2016-07-15)
Our knowledge of the molecular events underlying type 2 diabetes mellitus-a protein conformational disease characterized by the aggregation of islet amyloid polypeptide (IAPP) in pancreatic β cells-is limited. However, amyloid-mediated membrane damage is known to play a key role in
Influence of Aluminium and EGCG on Fibrillation and Aggregation of Human Islet Amyloid Polypeptide.
Xu ZX
Journal of Diabetes Research, 2016:1867059, 1-14 (2016)
The Role of Cholesterol in Driving IAPP- Interactions.
Sciacca MF
Biophysical Journal, 111(1), 140-151 (2016)
Zhi-Xue Xu et al.
Journal of diabetes research, 2016, 1867059-1867059 (2017-01-12)
The abnormal fibrillation of human islet amyloid polypeptide (hIAPP) has been implicated in the development of type II diabetes. Aluminum is known to trigger the structural transformation of many amyloid proteins and induce the formation of toxic aggregate species. The

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique