MSST0048

SILu^™Lite SOST, Sclerostin human

recombinant, expressed in HEK 293 cells, MS Protein Standard

• Code UNSPSC : 23201100
• Nomenclature NACRES : NA.12

Propriétés

• Source biologique: human
• Niveau de qualité: 200
• Produit recombinant: expressed in HEK 293 cells
• Étiquette/Marqueur: 8-His tagged
• Essai: ≥98% (SDS-PAGE)
• Forme: lyophilized powder
• Technique(s): mass spectrometry (MS): suitable
• Adéquation: suitable for mass spectrometry (internal calibrator)
• Numéro d'accès UniProt: Q9BQB4
• Température de stockage: −20°C
• Informations sur le gène: human ... SOST(50964)

Description

Description générale

SILu^™Lite SOST is a recombinant human protein expressed in human 293 cells. It consists of 201 amino acids (including a N-terminal polyhistidine and tag), with a calculated molecular mass of 22.8 kDa. SILu^™Lite SOST is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Actions biochimiques/physiologiques

Sclerostin is a secreted Wnt signaling antagonist produced almost exclusively by osteocytes. It can selectively inhibit Wnt/ β-catenin, suppressing the activity of osteoblasts as well as the viability of osteoblasts and osteocytes. Lower sclerostin levels are associated with lower bone mineral content and bone. It was demonstrated that greater total limb bone mineral content was significantly associated with greater circulating levels of sclerostin. In addition, circulating sclerostin is a biomarker of osteoporosis severity in long-term, chronic paraplegia. Serum sclerostin was associated significantly, independently, and positively with bone mineral density of both cortical and cancellous bone. Sclerostin is considered to be one of the factors associated with chronic kidney disease-mineral and bone disorder in hemodialysis patients.

Séquence

HHHHHHHHGGQQGWQAFKNDATEIIPELGEYPEPPPELENNKTMNRAENGGRPPHHPFETKDVSEYSCRELHFTRYVTDGPCRSAKPVTELVCSGQCGPARLLPNAIGRGKWWRPSGPDFRCIPDRYRAQRVQLLCPGGEAPRARKVRLVASCKCKRLTRFHNQSELKDFGTEAARPQKGRKPRPRARSAKANQAELENAY

Forme physique

Supplied as a lyophilized powder containing phosphate buffered saline.

Informations légales

SILu is a trademark of Sigma-Aldrich Co. LLC

Informations sur la sécurité

• Code de la classe de stockage: 11 - Combustible Solids
• Classe de danger pour l'eau (WGK): WGK 2
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable