Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

MSQC11

Sigma-Aldrich

SILuMAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody

Synonyme(s) :

Mass spectrometry standard, Adalimumab, SIL Adalimumab, Stable isotope labelled Adalimumab

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
41105501
Nomenclature NACRES :
NA.41

Produit recombinant

expressed in CHO cells

Niveau de qualité

Type de produit anticorps

primary antibodies

Essai

≥90% (SDS-PAGE)

Conditionnement

vial of 100 μg

Conditions d'expédition

wet ice

Température de stockage

−20°C

Description générale

SILu MAb Adalimumab Stable-Isotope Labeled Monoclonal Antibody is a recombinant, stable isotope labeled, monoclonal antibody which incorporates [13C6, 15N4]-Arginine and [13C6, 15N2]-Lysine. Expressed in CHO cells, SILuMAb Adalimumab is designed to be used as an internal standard for analysis of Adalimumab in human serum. Each vial of SILuMAb Adalimumab contains the labeled antibody lyophilized from a solution of phosphate buffered saline. Vial content was determined by measuring A280 and using an extinction coefficient (E0.1%) of 1.4.
SILu MAb Adalimumab is for R&D use only. Not for drug, household, or other uses.

Immunogène

SILuMab Adalimumab Heavy Chain: EVQLVESGGGLVQPGRSLRLSCAASGFTFDDYAMHWVRQAPGKGLEWVSAITWNSGHIDYADSVEGR
FTISRDNAKNSLYLQMNSLRAEDTAVYYCAKVSYLSTASSLDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNS
GALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEV
TCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRD
ELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG

SILuMab Adalimumab Light Chain:
DIQMTQSPSSLSASVGDRVTITCRASQGIRNYLAWYQQKPGKAPKLLIYAASTLQSGVPSRFSGSGSGTDFTLTISSLQPEDVATYYCQRYNRAPYTFGQGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Séquence

Adalimumab-Specific Peptide Sequences Liberated from SILuMAb Adalimumab by Tryptic Digest

Universal Peptide Sequence Location
GLEWVSAITWNSGHIDYADSVEGRHeavy chain
APYTFGQGTKLight chain
FSGSGSGTDFTLTISSLQPEDVATYYCQRLight chain

Notes préparatoires

Produced utilizing enriched media containing stable isotope labeled amino acids are 13C6, 15N4-labeled Arginine and 13C6, 15N2-labeled Lysine.
SILuMab Adalimumab is designed to be used as a internal standard for analysis of Adalimumab in human serum.

Reconstitution

Each vial of SILuMab Adalimumab contains the labeled antibody in a lyophilized form containing phosphate buffered saline.
SILuMab Adalimumab recovery is maximized when 0.1% formic acid is used for reconstitution of the lyophilized product.Reconstitution with other solvents may reduce recovery. Do not freeze after reconstitution.

  • Briefly centrifuge the vial at ~10,000 × g to collect the product at the bottom of the vial.
  • Add 500 μL of ultrapure water containing 0.1% formic acid to the vial.
  • Mix the contents by gently inverting the vial a minimum of 5 times.
  • Allow the vial to stand at room temperature for at least 15 minutes and repeat mixing by inversion.

Remarque sur l'analyse

Quantitative
MRM settings provided (xls)

Informations légales

This product is licensed under U.S. Patent No. 7,396,688 and foreign counterparts from E. I. du Pont de Nemours and Company. The purchase of this product conveys to the buyer the nontransferable right to use the purchased amount of the product for research and development only, including services for a third party for consideration. The buyer cannot sell or otherwise transfer this product, its components or materials made using this product or its components to a third party. Information about licenses for excluded uses is available from: E. I. du Pont de Nemours and Company; Attn: Associate Director, Commercial Development; DuPont Experimental Station E268; 200 Powdermill Rd.; Wilmington, DE 19803; 1-877-881-9787 (voice), 1-302-695-1437 (fax), licensing@dupont.com.
SILu is a trademark of Sigma-Aldrich Co. LLC

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

13 - Non Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Articles

Infliximab and Adalimumab monoclonal antibodies (mAbs) are used widely to treat rheumatoid arthritis, psoriatic arthritis, and many autoimmune diseases by binding to tumor necrosis factor-alpha (TNFα) to reduce the inflammatory response.

Development of Simple and Rapid Workflows for Quantitation of Infliximab and Adalimumab in Human Serum by LC-MS/MS

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique