Accéder au contenu
MilliporeSigma
Toutes les photos(3)

Principaux documents

M6574

Sigma-Aldrich

Membrane Scaffold Protein 1D1

recombinant, expressed in E. coli

Synonyme(s) :

MSP1D1, MSP1T2

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352202
Nomenclature NACRES :
NA.26

Source biologique

microbial

Niveau de qualité

Produit recombinant

expressed in E. coli

Description

N-Terminal histidine-tagged

Forme

lyophilized powder

Poids mol.

Mw 24661.9 by amino acid sequence

ε (coefficient d'extinction)

18200 M-1cm-1 at 280 nm (His-tag-cleaved dissolved in 20 mM Tris pH 7.4, 0.1M NaCl, 0.5mM EDTA and 0.01%NaN3)(lit.)
21000 M-1cm-1 at 280 nm (uncleaved His-tagged dissolved in 20 mM Tris pH 7.4, 0.1M NaCl, 0.5mM EDTA and 0.01%NaN3)(lit.)

Température de stockage

−20°C

Vous recherchez des produits similaires ? Visite Guide de comparaison des produits

Application

For an extensive list of citations and protocols visit the Sligar Lab Website at; sligarlab.life.uiuc.edu/nanodisc.html
For guidelines on the use of this and other MSP′s to prepare Nanodiscs, please visit our Protocols for Membrane Scaffold Proteins and Nanodisc Formation page.
Membrane Scaffold Protein 1D1 has been used as a scaffolding protein to stabilize lipid nanodiscs (NDs). It has also been used for the preparation of nanodiscs.
Nanodisc soluble lipid bilayer systems have proven to be a widely applicable means for rendering membrane proteins soluble in aqueous solutions in a native-like bilayer environment where they remain monodisperse and active. The critical component of nanodiscs is the encircling amphipathic helical protein belt (membrane scaffold protein).
The nanodisc system has been employed to incorporate a wide variety of proteins including GPCRs, P450s, bacteriorhodopsin, coagulation factors, cholera toxin, TAR receptor and aromatase.

Actions biochimiques/physiologiques

Generates Nanodiscs ~9.7 nm in diameter
Membrane scaffold protein 1D1 (MSP1D1) is derived from apolipoprotein A-I. It is an amphipathic synthetic protein, which self assembles to form nanodiscs.

Propriétés physiques

Sequence:GHHHHHHHDYDIPTTENLYFQGSTFSKLREQLGPVTQEFWDNLEKETEGLRQEMSKDLEEVKAKVQPYLDDFQKKWQEEMELYRQKVEPLRAELQEGARQKLHELQEKLSPLGEEMRDRARAHVDALRTHLAPYSDELRQRLAARLEALKENGGARLAEYHAKATEHLSTLSEKAKPALEDLRQGLLPVLESFKVSFLSALEEYTKKLNTQ

Forme physique

Supplied as a lyophilized histidine-tagged protein with a TEV protease cleavage site stabilized with Tris-HCl, EDTA, and NaCl.

Informations légales

Nanodisc technology, and many of its uses, are covered by the following patents held by the University of Illinois.
  • 7,691,414 Membrane scaffold proteins
  • 7,662,410 Membrane scaffold proteins and embedded membrane proteins
  • 7,622,437 Tissue factor compositions and methods
  • 7,592,008 Membrane scaffold proteins
  • 7,575,763 Membrane scaffold proteins and tethered membrane proteins
  • 7,083,958 Membrane scaffold proteins
  • 7,048,949 Membrane scaffold proteins

Pictogrammes

Exclamation mark

Mention d'avertissement

Warning

Mentions de danger

Conseils de prudence

Classification des risques

Eye Irrit. 2 - Skin Irrit. 2 - STOT SE 3

Organes cibles

Respiratory system

Code de la classe de stockage

11 - Combustible Solids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Time-course and degradation rate of membrane scaffold protein (MSP1D1) during recombinant production
Faas R, et al.
Biotechnology reports (Amsterdam, Netherlands), 17, 45-48 (2018)
Lipid nanotechnologies for structural studies of membrane-associated proteins
Stoilova-McPhie S, et al.
Proteins: Structure, Function, and Bioinformatics, 82(11), 2902-2909 (2014)
Lipid nanotechnologies for structural studies of membrane-associated proteins.
Stoilova-McPhie, S., et al.
Proteins: Structure, Function, and Genetics, 82(11), 2902-2909 (2014)
Synaptosomes (2018)
Tomasz Uchański et al.
Nature methods, 18(1), 60-68 (2021-01-08)
Nanobodies are popular and versatile tools for structural biology. They have a compact single immunoglobulin domain organization, bind target proteins with high affinities while reducing their conformational heterogeneity and stabilize multi-protein complexes. Here we demonstrate that engineered nanobodies can also

Articles

Read our article about how the Nanodisc system allows for structural studies of membrane proteins.

Protocoles

Protocols for Membrane Scaffold Proteins and Nanodisc Formation

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique