Accéder au contenu
MilliporeSigma
Toutes les photos(3)

Principaux documents

HPA026809

Sigma-Aldrich

Anti-SIRT3 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-SIR2L3, Anti-sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Numéro MDL:
Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

recombinant expression
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

Séquence immunogène

FSVGASSVVGSGGSSDKGKLSLQDVAELIRARACQRVVVMVGAGISTPSGIPDFRSPGSGLYSNLQQYDLPYPEAIFELPFFFHNPKPFFTLAKELYPGNYKPNVTHYFLRLLHDKGLLLRLYT

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SIRT3(23410)

Description générale

Sirtuin 3 (SIRT3) is a 399 amino acid protein, which belongs to the Sirtuins (SIRTs), a family of nicotinamide adenine dinucleotide (NAD+)-dependent deacetylases. Increased expression of SIRT3 is connected with extended lifespan of humans. SIRT3 gene is mapped to human chromosome 11p15.5. The protein is characterized with N-terminal mitochondrial targeting signal and a central catalytic domain. SIRT3 is expressed in several tissues including adipose tissue, brain and heart in both fetus and adults. It is also referred to as SIR2L3 (SIR2-like protein 3).

Immunogène

sirtuin (silent mating type information regulation 2 homolog) 3 (S. cerevisiae) recombinant protein epitope signature tag (PrEST)

Application

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Actions biochimiques/physiologiques

Sirtuin 3 (SIRT3) plays a vital role in the regulation of enzymes involved in various cellular pathways, such as respiratory chain, ATP synthesis, β-oxidation, tricarboxylic acid cycle and urea cycle, and decreases concentration of reactive oxygen species (ROS) and oxidative stress. SIRT3 is a novel gene involved in human ageing, therefore any abnormalities in the gene leads to several age-related diseases, such as cancer, metabolic syndrome, cardiovascular disease, and neurodegenerative diseases. SIRT3 facilitates mitochondrial function and metabolism. Sirt3 modulates energy homeostasis via regulation of basal ATP levels.3 Inhibition of SIRT3 by LC-0296, might facilitate the development of new targeted therapies to treat patients with head and neck cancer.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST70480

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Genetic and Functional Sequence Variants of the SIRT3 Gene Promoter in Myocardial Infarction.
Yin X
PLoS ONE, 11(4) (2016)
A Novel Sirtuin-3 Inhibitor, LC-0296, Inhibits Cell Survival and Proliferation, and Promotes Apoptosis of Head and Neck Cancer Cells.
Alhazzazi TY
Anticancer Research, 36(1), 49-60 (2016)
Variability of the SIRT3 gene, human silent information regulator Sir2 homologue, and survivorship in the elderly.
Rose G
Experimental Gerontology, 38(10), 1065-1070 (2003)
A role for the mitochondrial deacetylase Sirt3 in regulating energy homeostasis.
Ahn BH
Proceedings of the National Academy of Sciences of the USA, 105(38), 14447-14452 (2008)
Isha Sharma et al.
Biomedicines, 8(7) (2020-07-28)
Obesity is associated with perturbations in cellular energy homeostasis and consequential renal injury leading to chronic renal disease (CKD). Myo-inositol oxygenase (MIOX), a tubular enzyme, alters redox balance and subsequent tubular injury in the settings of obesity. Mechanism(s) for such

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique