Accéder au contenu
MilliporeSigma
Toutes les photos(6)

Principaux documents

HPA017051

Sigma-Aldrich

Anti-DNAJB11 antibody produced in rabbit

enhanced validation

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonyme(s) :

Anti-DnaJ homolog subfamily B member 11 precursor antibody produced in rabbit, Anti-ER-associated Hsp40 co-chaperone antibody produced in rabbit, Anti-ER-associated dnaJ protein 3 antibody produced in rabbit, Anti-ErJ3 antibody produced in rabbit, Anti-PWP1-interacting protein 4 antibody produced in rabbit, Anti-hDj9 antibody produced in rabbit

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Numéro HPA (Human Protein Atlas):
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Gamme de produits

Prestige Antibodies® Powered by Atlas Antibodies

Forme

buffered aqueous glycerol solution

Espèces réactives

human

Validation améliorée

recombinant expression
Learn more about Antibody Enhanced Validation

Technique(s)

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:20-1:50

Séquence immunogène

DSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEVTLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... DNAJB11(51726)

Vous recherchez des produits similaires ? Visite Guide de comparaison des produits

Description générale

DNAJB11 (DnaJ (Hsp40) homolog, subfamily B, member 11) is a chaperone of the endoplasmic reticulum belonging to the endoplasmic reticulum (ER) Hsp40/DnaJ family. It is a component of quality control system of ER-associated degradation (ERAD). It contains the J domain, which is a highly conserved region made of 75 amino acids. It also shares certain domains with other HSP40 chaperones. These domains include a C-terminal domain, a glycine/phenylalanine-rich putative linker region and a cystine-rich domain. DNAJB11 is expressed ubiquitously, and has the highest expression in secretory tissues.

Immunogène

DnaJ homolog subfamily B member 11 precursor recombinant protein epitope signature tag (PrEST)

Application

Anti-DNAJB11 antibody is suitable for immunoprecipitation.
Anti-DNAJB11 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Actions biochimiques/physiologiques

DNAJB11 (DnaJ (Hsp40) homolog, subfamily B, member 11) is a component of unassembled immunoglobulin (Ig) heavy chain: BiP (binding immunoglobulin protein) complex, where it acts as a co-factor for BiP, and helps in folding and assembly of proteins. It plays a major role in mammalian cell resistance to vero toxin. It is also involved in ER (endoplasmic reticulum) stress tolerance. It is secreted in the extracellular space, where it binds to mis-folded proteins and prevents their aggregation. It also reduces the toxicity of disease-related prion protein. DNAJB11 is involved in the intoxication pathway of cholera toxin.

Caractéristiques et avantages

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Liaison

Corresponding Antigen APREST71693

Forme physique

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informations légales

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 1

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Équipement de protection individuelle

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Wen-Li Lu et al.
Evidence-based complementary and alternative medicine : eCAM, 2014, 192749-192749 (2014-11-13)
Akebia Fructus has long been used for hepatocellular carcinoma (HCC) in China, while the molecular mechanism remains obscure. Our recent work found that Akebia trifoliate (Thunb.) Koidz seed extract (ATSE) suppressed proliferation and induced endoplasmic reticulum (ER) stress in SMMC-7721.
Shane Massey et al.
Infection and immunity, 79(11), 4739-4747 (2011-08-17)
Cholera toxin (CT) is endocytosed and transported by vesicle carriers to the endoplasmic reticulum (ER). The catalytic CTA1 subunit then crosses the ER membrane and enters the cytosol, where it interacts with its Gsα target. The CTA1 membrane transversal involves
Joseph C Genereux et al.
The EMBO journal, 34(1), 4-19 (2014-11-02)
The Unfolded Protein Response (UPR) indirectly regulates extracellular proteostasis through transcriptional remodeling of endoplasmic reticulum (ER) proteostasis pathways. This remodeling attenuates secretion of misfolded, aggregation-prone proteins during ER stress. Through these activities, the UPR has a critical role in preventing
M Yu et al.
The Journal of biological chemistry, 275(32), 24984-24992 (2000-05-29)
Hsp40 co-chaperones, characterized by the presence of a highly conserved J domain, are involved in nearly all aspects of protein synthesis, folding, and secretion. Within the lumen of the endoplasmic reticulum, these chaperones are also involved in reverse translocation and
K W Wen et al.
Oncogene, 29(24), 3532-3544 (2010-04-27)
Kaposi sarcoma-associated herpesvirus (KSHV) is a member of the gammaherpesvirus family. It is the etiological agent of three different human cancers, Kaposi sarcoma (KS), primary effusion lymphoma (PEL) and multicentric Castleman disease. The far left end of the KSHV genome

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique