Accéder au contenu
MilliporeSigma
Toutes les photos(2)

Principaux documents

AV50850

Sigma-Aldrich

Anti-WDFY3 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-ALFY, Anti-KIAA0993, Anti-MGC16461, Anti-WD repeat and FYVE domain containing 3, Anti-ZFYVE25

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

90 kDa

Espèces réactives

bovine, human, pig, rabbit, dog, mouse, horse

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... WDFY3(23001)

Immunogène

Synthetic peptide directed towards the C terminal region of human WDFY3

Application

Anti-WDFY3 antibody produced in rabbit is suitable for western blotting at a concentration of 1.0μg/ml.

Actions biochimiques/physiologiques

WD repeat and FYVE domain containing 3 (WDFY3) is a phosphatidylinositol 3-phosphate-binding protein that shuttles from nuclear membrane and forms complexes with aggregated proteins. It is important for clearance of aggregate proteins and induction of autophagy.

Séquence

Synthetic peptide located within the following region: EKLADAVRFLGCFSDLRKISAMNVFPSNTQPFQRLLEEDVISIESVSPTL

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

P Isakson et al.
Cell death and differentiation, 20(1), 12-20 (2012-06-02)
Autophagy, a highly conserved lysosomal degradation pathway, was initially characterized as a bulk degradation system induced in response to starvation. In recent years, autophagy has emerged also as a highly selective pathway, targeting various cargoes such as aggregated proteins and
Terje Høyvarde Clausen et al.
Autophagy, 6(3), 330-344 (2010-02-20)
Accumulation of ubiquitinated proteins in cytoplasmic and/or nuclear inclusions is a hallmark of several diseases associated with premature cell death. SQSTM1/p62 is known to bind ubiquitinated substrates and aid their aggregation and degradation by macroautophagy. We show here that p62
Tsung Lin Tsai et al.
Oncotarget, 8(53), 91209-91222 (2017-12-07)
Wheat germ agglutinin (WGA) is a lectin that specifically binds cell surface glycoproteins and disrupts nuclear pore complex function through its interaction with POM121. Our data indicate WGA induces paraptosis-like cell death without caspase activation. We observed the main features

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique