Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

AV50777

Sigma-Aldrich

Anti-DNER antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-δ/Notch-like EGF repeat containing, Anti-Bet, Anti-UNQ26

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.43

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

50 kDa

Espèces réactives

mouse, horse, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_620711

Numéro d'accès UniProt

Q8NFT8

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... DNER(92737)

Immunogène

Synthetic peptide directed towards the middle region of human DNER

Application

Anti-DNER antibody produced in rabbit is suitable for western blotting at a concentration of 5.0μg/ml.

Actions biochimiques/physiologiques

Delta/notch-like EGF repeat containing (DNER) is a non-canonical Notch ligand expressed in developing and adult neurons. It may be involved in the differentiation of neurospheres in vitro and in vivo and in the regulation of neuritogenesis.

Séquence

Synthetic peptide located within the following region: DACQRKPCQNNASCIDANEKQDGSNFTCVCLPGYTGELCQSKIDYCILDP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
QC20566

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Peng Sun et al.
Stem cells (Dayton, Ohio), 27(7), 1473-1486 (2009-06-23)
Neurospheres derived from glioblastoma (GBM) and other solid malignancies contain neoplastic stem-like cells that efficiently propagate tumor growth and resist cytotoxic therapeutics. The primary objective of this study was to use histone-modifying agents to elucidate mechanisms by which the phenotype
Nobuna Fukazawa et al.
Molecular and cellular biology, 28(14), 4494-4506 (2008-05-14)
Protein tyrosine phosphatase zeta (PTPzeta) is a receptor type protein tyrosine phosphatase that uses pleiotrophin as a ligand. Pleiotrophin inactivates the phosphatase activity of PTPzeta, resulting in the increase of tyrosine phosphorylation levels of its substrates. We studied the functional
Byron H Hartman et al.
Journal of the Association for Research in Otolaryngology : JARO, 11(2), 187-201 (2010-01-09)
The Notch signaling pathway is known to play important roles in inner ear development. Previous studies have shown that the Notch1 receptor and ligands in the Delta and Jagged families are important for cellular differentiation and patterning of the organ

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique