Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

AV49048

Sigma-Aldrich

Anti-CDYL2 antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-Chromodomain protein, Y-like 2, Anti-FLJ38866

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

56 kDa

Espèces réactives

guinea pig, human, mouse, bovine, rat, horse, rabbit

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... CDYL2(124359)

Immunogène

Synthetic peptide directed towards the N terminal region of human CDYL2

Application

Anti-CDYL2 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5μg/ml.

Actions biochimiques/physiologiques

Chromodomain protein, Y-like 2 (CDYL2) belongs to the family of chromodomain Y chromosome (CDY) proteins that mediate histone acetylation during spermiogenesis and regulation of transcription corepressors. CDYL2 binds to multiple ARK(S/T) motifs and is present in all mammals.

Séquence

Synthetic peptide located within the following region: NPPLAKPKKGYSGKPSSGGDRATKTVSYRTTPSGLQIMPLKKSQNGMENG

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Steve Dorus et al.
Human molecular genetics, 12(14), 1643-1650 (2003-07-03)
Theories predict that the long-term survival of duplicated genes requires their functional diversification, which can be accomplished by either subfunctionalization (the partitioning of ancestral functions among duplicates) or neofunctionalization (the acquisition of novel function). Here, we characterize the CDY-related mammalian
Wolfgang Fischle et al.
The Journal of biological chemistry, 283(28), 19626-19635 (2008-05-03)
Previous studies have shown two homologous chromodomain modules in the HP1 and Polycomb proteins exhibit discriminatory binding to related methyllysine residues (embedded in ARKS motifs) of the histone H3 tail. Methylated ARK(S/T) motifs have recently been identified in other chromatin

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique