Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

AV46947

Sigma-Aldrich

Anti-PILRA antibody produced in rabbit

affinity isolated antibody

Synonyme(s) :

Anti-FDF03, Anti-Paired immunoglobin-like type 2 receptor α

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme
Toutes les photos(1)

About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

100

Conjugué

unconjugated

Forme d'anticorps

affinity isolated antibody

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

18 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

NP_840056

Numéro d'accès UniProt

Q9UKJ1-4

Conditions d'expédition

wet ice

Température de stockage

−20°C

Informations sur le gène

human ... PILRA(29992)

Immunogène

Synthetic peptide directed towards the N terminal region of human PILRA

Application

Anti-PILRA antibody produced in rabbit is suitable for western blotting at a concentration of 5μg/mL. It is also useful for immunohistochemistry at a concentration of 4-8μg/mL.

Actions biochimiques/physiologiques

PILRA (Paired immunoglobin-like type 2 receptor alpha) gene encodes a single-pass type I membrane protein predominantily expressed in immune cells like monocytes, granulocytes and dendritic cells. PILR-associating neural protein (PANP) is a ligand for PILRA that facilitates the immune system regulation. It plays a pivotal role in regulating cell signaling via SHP-1 by balancing the PILRalpha-mediated inhibition and PILRbeta-mediated activation. Additionally, PILRalpha facilitates as a coreceptor that acquaints with glycoprotein B (gB) and assists in herpes simplex virus-1 entry. Further, it regulates the membrane fusion of the viral envelope with cellular membranes during virus entry and virus-induced cell-to-cell fusion.

Séquence

Synthetic peptide located within the following region: IPFSFYYPWELATAPDVRISWRRGHFHRQSFYSTRPPSIHKDYVNRLFLN

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable

Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number
QC19082

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Rechercher un(e) COA

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Takeshi Satoh et al.
Cell, 132(6), 935-944 (2008-03-25)
Glycoprotein B (gB) is one of the essential components for infection by herpes simplex virus-1 (HSV-1). Although several cellular receptors that associate with glycoprotein D (gD), such as herpes virus entry mediator (HVEM) and Nectin-1, have been identified, specific molecules
Shigekazu Tabata et al.
Acta crystallographica. Section F, Structural biology and crystallization communications, 64(Pt 1), 44-46 (2007-12-22)
Human paired immunoglobulin-like (Ig-like) type 2 receptor alpha (PILRalpha) is a type I membrane protein that is mainly expressed in immune-related cells such as monocytes, granulocytes and dendritic cells. PILRalpha can suppress the functions of such immune cells because it
Amane Kogure et al.
Biochemical and biophysical research communications, 405(3), 428-433 (2011-01-19)
PILRα is an immune inhibitory receptor possessing an immunoreceptor tyrosine-based inhibitory motif (ITIM) in its cytoplasmic domain enabling it to deliver inhibitory signals. Binding of PILRα to its ligand CD99 is involved in immune regulation; however, whether there are other

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique