Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

AV46038

Sigma-Aldrich

Anti-MTHFD2 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 2, Anti-NMDMC

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

35 kDa

Espèces réactives

human, rabbit, dog, bovine, mouse, rat, horse, guinea pig

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... MTHFD2(10797)

Immunogène

Synthetic peptide directed towards the N terminal region of human MTHFD2

Application

Anti-MTHFD2 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25μg/ml.

Actions biochimiques/physiologiques

MTHFD2 encodes a mitochondrial bifunctional enzyme methylenetetrahydrofolate dehydrogenase/cyclohydrolase with NAD-dependent methylenetetrahydrofolate dehydrogenase and methenyltetrahydrofolate cyclohydrolase domain. Decrease in MTHFD2 expression leads to impairment of cell migration and invasion into extracellular matrix and reduces the cell fraction with a high CD44 expression. It facilitates the regulation of breast cancer cell migration and invasion.

Séquence

Synthetic peptide located within the following region: LPLPEHIDERRICNAVSPDKDVDGFHVINVGRMCLDQYSMLPATPWGVWE

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Laura Lehtinen et al.
Oncotarget, 4(1), 48-63 (2013-01-09)
Vimentin is an intermediate filament protein, with a key role in the epithelial to mesenchymal transition as well as cell invasion, and it is often upregulated during cancer progression. However, relatively little is known about its regulation in cancer cells.

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique