AV40324

Anti-CUGBP2 antibody produced in rabbit

affinity isolated antibody

• Synonyme(s) : Anti-BRUNOL3, Anti-CUG triplet repeat, RNA binding protein 2, Anti-ETR-3, Anti-NAPOR
• Code UNSPSC : 12352203
• Nomenclature NACRES : NA.41

Propriétés

• Source biologique: rabbit
• Niveau de qualité: 100
• Conjugué: unconjugated
• Forme d'anticorps: affinity isolated antibody
• Type de produit anticorps: primary antibodies
• Clone: polyclonal
• Forme: buffered aqueous solution
• Poids mol.: 56 kDa
• Espèces réactives: rabbit, mouse, dog, horse, rat, guinea pig, human, bovine
• Concentration: 0.5 mg - 1 mg/mL
• Technique(s): western blot: suitable
• Numéro d'accès NCBI: NP_006552
• Numéro d'accès UniProt: O95319
• Conditions d'expédition: wet ice
• Température de stockage: −20°C
• Modification post-traductionnelle de la cible: unmodified
• Informations sur le gène: human ... CUGBP2(10659)

Description

Description générale

CUGBP2 (ETR-3/NAPOR/BRUNOL3) is an RNA-binding protein, posttranscriptional controller of gene expression, that regulates key cellular responses such as apoptosis by binding to AU-rich sequences in the mRNA of important genes such as COX-2 and VEGF. CUGBP2 is a critical regulator of the apoptotic response to genotoxic injury in breast cancer cells and mitotic catastrophe response.

Spécificité

Anti-CUGBP2 polyclonal antibody reacts with chicken, zebrafish, bovine, human, mouse, rat, and canine RNA binding protein 2 proteins.

Immunogène

Synthetic peptide directed towards the N terminal region of human CELF2

Application

Anti-CUGBP2 polyclonal antibody is used to tag RNA binding protein 2 proteins for detection and quantitation by Western blotting and in cells and tissues by immunohistochemical (IHC) techniques. It is used as a probe to study the role of RNA binding protein 2 in the regulation of posttranslational gene transcription in response to gentotoxic injury.

Actions biochimiques/physiologiques

Members of the CELF/BRUNOL protein family contain two N-terminal RNA recognition motif (RRM) domains, one C-terminal RRM domain, and a divergent segment of 160-230 aa between the second and third RRM domains. Members of this protein family regulate pre-mRNA alternative splicing and may also be involved in mRNA editing, and translation. Alternative splicing results in multiple transcript variants encoding different isoforms.

Séquence

Synthetic peptide located within the following region: NIKTLPGMHHPIQMKPADSEKSNAVEDRKLFIGMVSKKCNENDIRVMFSP

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informations sur la sécurité

• Code de la classe de stockage: 10 - Combustible liquids
• Classe de danger pour l'eau (WGK): WGK 3
• Point d'éclair (°F): Not applicable
• Point d'éclair (°C): Not applicable