Accéder au contenu
MilliporeSigma
Toutes les photos(1)

Principaux documents

AV32810

Sigma-Aldrich

Anti-KLF1 antibody produced in rabbit

IgG fraction of antiserum

Synonyme(s) :

Anti-Kruppel-like factor 1 (erythroid)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

38 kDa

Espèces réactives

human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... KLF1(10661)

Description générale

Kruppel-like factor 1 (erythroid) is a transcription factor required for the proper differentiation of erythroid (red blood) cells from bipotent progenitor cells. Kruppel-like factor 1 regulates erythroid cell differenation and maturation via the processes of transcriptional activation, gamma to β globin switching and chromatin remodeling.
Rabbit polyclonal anti-KLF1 antibody reacts with pig, human, and bovine Kruppel-like factor 1 (erythroid) transcription factors.

Immunogène

Synthetic peptide directed towards the middle region of human KLF1

Application

Rabbit Anti-KLF1 antibody can be used for western blot applications at a concentration of 2.5μg/ml.
Rabbit polyclonal anti-KLF1 antibody is used to tag Kruppel-like factor 1 (erythroid) for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of Kruppel-like factor 1 (erythroid) in erythroid cell differentiation and maturation.

Actions biochimiques/physiologiques

KLF1 is a transcription factor, originally identified in this laboratory, which plays a crucial role as a transcriptional activator at the adult beta-globin locus.

Séquence

Synthetic peptide located within the following region: SVPAASGAPYGLLSGYPAMYPAPQYQGHFQLFRGLQGPAPGPATSPSFLS

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique