Accéder au contenu
MilliporeSigma
Toutes les photos(3)

Principaux documents

AV32470

Sigma-Aldrich

Anti-SUV39H1 Histone Methyltransferase antibody

rabbit polyclonal

Synonyme(s) :

Anti-KMT1A, Anti-MG44, Anti-SUV39H, Anti-Suppressor of variegation 3-9 homolog 1 (Drosophila)

Se connecterpour consulter vos tarifs contractuels et ceux de votre entreprise/organisme


About This Item

Code UNSPSC :
12352203
Nomenclature NACRES :
NA.41

Nom du produit

Anti-SUV39H1 antibody produced in rabbit, IgG fraction of antiserum

Source biologique

rabbit

Niveau de qualité

Conjugué

unconjugated

Forme d'anticorps

IgG fraction of antiserum

Type de produit anticorps

primary antibodies

Clone

polyclonal

Forme

buffered aqueous solution

Poids mol.

48 kDa

Espèces réactives

rat, bovine, guinea pig, dog, rabbit, mouse, human

Concentration

0.5 mg - 1 mg/mL

Technique(s)

immunohistochemistry: suitable
western blot: suitable

Numéro d'accès NCBI

Numéro d'accès UniProt

Conditions d'expédition

wet ice

Température de stockage

−20°C

Modification post-traductionnelle de la cible

unmodified

Informations sur le gène

human ... SUV39H1(6839)

Description générale

Rabbit polyclonal anti-SUV39H1 antibody reacts with human, mouse, rat, zebrafish, bovine, and canine suppressor of variegation 3-9 homolog 1 enzymes.
Suppressor of variegation 3-9 homolog 1 (SUV39H1, KMT1A, MG44) is a histone-lysine N-methyltransferase that methylates lys-9 of histone H3. SUV39H1 is involved in heterochromatin organization, chromosome segregation, and mitotic progression. SUV39H1 generates a gradient of methylation marks at the kinetochore to spatiotemporally direct accurate chromosome segregation in mitosis. Suv39H1 interacts with Snail to mediated E-cadherin, a hallmark of epithelial-mesenchymal transition (EMT), repression in breast cancer.

Immunogène

Synthetic peptide directed towards the C terminal region of human SUV39H1

Application

Rabbit Anti-SUV39H1 antibody can be used for western blot applications at a concentration of 1.25μg/ml.
Rabbit polyclonal anti-SUV39H1 antibody is used to tag suppressor of variegation 3-9 homolog 1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of suppressor of variegation 3-9 homolog 1 in the regulation of chromatin organization and chromosome segregation and as a regulator or cancer progression via E-cadherin-dependent epithelial-mesenchymal transition (EMT).

Actions biochimiques/physiologiques

SUV39H1, a human homolog of the Drosophila position effect variegation modifier Su(var)3-9 and of the S. pombe silencing factor clr4, encodes a heterochromatic protein that transiently accumulates at centromeric positions during mitosis.This gene is a member of the suppressor of variegation 3-9 homolog family and encodes a protein with a chromodomain and a C-terminal SET domain. This nuclear protein moves to the centromeres during mitosis and functions as a histone methyltransferase, methylating Lys-9 of histone H3. Overall, it plays a vital role in heterochromatin organization, chromosome segregation, and mitotic progression. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Séquence

Synthetic peptide located within the following region: FDYNMQVDPVDMESTRMDSNFGLAGLPGSPKKRVRIECKCGTESCRKYLF

Forme physique

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Clause de non-responsabilité

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Vous ne trouvez pas le bon produit ?  

Essayez notre Outil de sélection de produits.

Code de la classe de stockage

10 - Combustible liquids

Classe de danger pour l'eau (WGK)

WGK 3

Point d'éclair (°F)

Not applicable

Point d'éclair (°C)

Not applicable


Faites votre choix parmi les versions les plus récentes :

Certificats d'analyse (COA)

Lot/Batch Number

Vous ne trouvez pas la bonne version ?

Si vous avez besoin d'une version particulière, vous pouvez rechercher un certificat spécifique par le numéro de lot.

Déjà en possession de ce produit ?

Retrouvez la documentation relative aux produits que vous avez récemment achetés dans la Bibliothèque de documents.

Consulter la Bibliothèque de documents

Notre équipe de scientifiques dispose d'une expérience dans tous les secteurs de la recherche, notamment en sciences de la vie, science des matériaux, synthèse chimique, chromatographie, analyse et dans de nombreux autres domaines..

Contacter notre Service technique