WH0005253M2

Monoclonal Anti-PHF2 antibody produced in mouse

clone 3E7, ascites fluid

• Synonym(s): Anti-GRC5, Anti-KIAA0662, Anti-PHD finger protein 2
• MDL number: MFCD03791931
• UNSPSC Code: 12352203
• NACRES: NA.41

Properties

• biological source: mouse
• conjugate: unconjugated
• antibody form: ascites fluid
• antibody product type: primary antibodies
• clone: 3E7, monoclonal
• species reactivity: human
• technique(s): indirect ELISA: suitable; western blot: 1:500-1:1000
• isotype: IgMκ
• GenBank accession no.: NM_005392
• UniProt accession no.: O75151
• shipped in: dry ice
• storage temp.: −20°C
• target post-translational modification: unmodified
• Gene Information: human ... PHF2(5253)

Description

General description

This gene encodes a protein which contains a zinc finger-like PHD (plant homeodomain) finger, distinct from other classes of zinc finger motifs, and a hydrophobic and highly conserved domain. The PHD finger shows the typical Cys4-His-Cys3 arrangement. PHD finger genes are thought to belong to a diverse group of transcriptional regulators possibly affecting eukaryotic gene expression by influencing chromatin structure. (provided by RefSeq)

Immunogen

PHF2 (NP_005383, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWHKHGPGQAPDVKPVQNGSQLFIKELRSRTFPS

Physical form

Solution

Legal Information

GenBank is a registered trademark of United States Department of Health and Human Services

Safety Information

• Storage Class: 10 - Combustible liquids
• flash_point_f: Not applicable
• flash_point_c: Not applicable
• ppe: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)