All Photos(2)

Key Documents

SAB1411877

Anti-Huntingtin Disease (HD/HTT) Antibody

Name: Anti-Huntingtin Disease (HD/HTT) Antibody
Brand: SIGMA

mouse monoclonal, 1C10

Synonym(s):

HD, IT15

Sign Into View Organizational & Contract Pricing

All Photos(2)

About This Item

UNSPSC Code:

12352203

NACRES:

NA.41

Pricing and availability is not currently available.

Product Name

ANTI-HD antibody produced in mouse, clone 1C10, purified immunoglobulin, buffered aqueous solution

biological source

mouse

conjugate

unconjugated

antibody form

purified immunoglobulin

antibody product type

primary antibodies

clone

1C10, monoclonal

form

buffered aqueous solution

mol wt

antigen 37.07 kDa

species reactivity

human

technique(s)

indirect ELISA: suitable
indirect immunofluorescence: suitable
western blot: 1-5 μg/mL

Compare Similar Items

View Full Comparison

Show Differences

1 of 4

This Item	SAB1411856	SAB1405932	SAB1412153
SAB1411877 ANTI-HD antibody produced in mouse	SAB1411856 ANTI-HD antibody produced in mouse	SAB1405932 Anti-HGD antibody produced in mouse	SAB1412153 ANTI-T antibody produced in mouse
biological source mouse	biological source mouse	biological source mouse	biological source mouse
antibody form purified immunoglobulin	antibody form purified immunoglobulin	antibody form purified immunoglobulin	antibody form purified immunoglobulin
conjugate unconjugated	conjugate unconjugated	conjugate unconjugated	conjugate unconjugated
clone 1C10, monoclonal	clone 1H6, monoclonal	clone polyclonal	clone 5C6, monoclonal
species reactivity human	species reactivity human	species reactivity human	species reactivity human

Immunogen

HD (NP_002102, 1524 a.a. ~ 1627 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CDGIMASGRKAVTHAIPALQPIVHDLFVLRGTNKADAGKELETQKEVVVSMLLRLIQYHQVLEMFILVLQQCHKENEDKWKRLSRQIADIILPMLAKQQMHIDS

Physical form

Solution in phosphate buffered saline, pH 7.4

Not finding the right product?

Try our Product Selector Tool.

Storage Class

10 - Combustible liquids

flash_point_f

Not applicable

flash_point_c

Not applicable

Choose from one of the most recent versions:

Certificates of Analysis (COA)

Lot/Batch Number

06223-1C10

12174-S102

Don't see the Right Version?

If you require a particular version, you can look up a specific certificate by the Lot or Batch number.

Search for a COA

Already Own This Product?

Find documentation for the products that you have recently purchased in the Document Library.

Visit the Document Library

Silencing mutant huntingtin by adeno-associated virus-mediated RNA interference ameliorates disease manifestations in the YAC128 mouse model of Huntington's disease.

Lisa M Stanek et al.

Human gene therapy, 25(5), 461-474 (2014-02-04)

Huntington's disease (HD) is a fatal autosomal dominant neurodegenerative disease caused by an increase in the number of polyglutamine residues in the huntingtin (Htt) protein. With the identification of the underlying basis of HD, therapies are being developed that reduce

Altered selenium status in Huntington's disease: neuroprotection by selenite in the N171-82Q mouse model.

Zhen Lu et al.

Neurobiology of disease, 71, 34-42 (2014-07-12)

Disruption of redox homeostasis is a prominent feature in the pathogenesis of Huntington's disease (HD). Selenium an essential element nutrient that modulates redox pathways and has been reported to provide protection against both acute neurotoxicity (e.g. methamphetamine) and chronic neurodegeneration

Huntingtin is required for normal excitatory synapse development in cortical and striatal circuits.

Spencer U McKinstry et al.

The Journal of neuroscience : the official journal of the Society for Neuroscience, 34(28), 9455-9472 (2014-07-11)

Huntington's disease (HD) is a neurodegenerative disease caused by the expansion of a poly-glutamine (poly-Q) stretch in the huntingtin (Htt) protein. Gain-of-function effects of mutant Htt have been extensively investigated as the major driver of neurodegeneration in HD. However, loss-of-function

Our team of scientists has experience in all areas of research including Life Science, Material Science, Chemical Synthesis, Chromatography, Analytical and many others.

Contact Technical Service